Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01925
Gene name
Locationscaffold_02:2106341..2107632
Strand+
Gene length (bp)1291
Transcript length (bp)1053
Coding sequence length (bp)1053
Protein length (aa) 351

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07859 Abhydrolase_3 alpha/beta hydrolase fold 2.2E-15 148 303
PF10340 Say1_Mug180 Steryl acetyl hydrolase 5.0E-15 135 276
PF20434 BD-FAE BD-FAE 1.6E-07 144 237

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum Signal peptide|Mitochondrial transit peptide 0.2505 0.2393 0.4305 0.0439 0.6285 0.1095 0.7941 0.1806 0.5412 0.0765

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2960
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6263
Ophiocordyceps australis map64 (Brazil) OphauB2|6562
Ophiocordyceps camponoti-floridani Ophcf2|01925 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1092
Ophiocordyceps kimflemingae Ophio5|8441
Ophiocordyceps subramaniannii Hirsu2|5025

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01925
MILGPISLFDCLVFCLLLAPQLIWHVGLVRTSGVVLRALPFLLLQLPVDLFRHWLWLPASRVPAFAREASPFEYL
VTRCVRYAFKYIPPDVANTFFSKSVSLPFLRWRMLRHGIVKFPVHWHEYEDGATVRGLWIRHDPSRSPDMVIYYL
HGGGFSMGSSHFYLEFLLTWAHLLVEAGFKNPAIFALDYTLVPKAVYPTQLSEVTRSYDQVLQVAGDASRVCVAG
DSAGGALILGLLQEIGAQAQEPGGLGIRVNASSVKAVPRIAALISPWLKLQSDTFPVSAMDYLDQETLWEYGFAY
AGEAMVNRHPASPGSCTDDELWKAAAPQRGHATASTSRRCGSTAESMPGR*
Coding >Ophcf2|01925
ATGATTCTCGGTCCCATCTCACTCTTCGACTGCCTCGTCTTCTGTCTCTTGCTGGCGCCGCAGCTGATATGGCAT
GTCGGCCTCGTTCGCACCAGCGGCGTCGTCCTCCGAGCCCTGCCCTTCCTACTGCTGCAGCTCCCTGTCGACCTG
TTCCGTCATTGGCTGTGGCTGCCTGCATCGCGCGTGCCTGCTTTTGCGCGCGAGGCGTCCCCGTTCGAGTATCTC
GTGACAAGATGCGTGCGATACGCATTCAAGTATATTCCGCCCGACGTCGCCAACACCTTCTTCTCCAAGAGTGTG
AGCCTGCCCTTCCTGCGATGGCGCATGTTGAGGCACGGCATCGTCAAGTTTCCCGTCCACTGGCATGAGTATGAG
GACGGCGCCACTGTCAGGGGCCTATGGATCAGGCATGATCCGAGCCGGTCCCCGGACATGGTCATCTATTATCTC
CACGGTGGCGGCTTCTCGATGGGCTCCTCTCATTTCTATCTCGAGTTTCTCCTGACCTGGGCCCATTTGCTCGTA
GAGGCTGGGTTCAAGAACCCTGCCATCTTCGCGCTCGACTACACTTTGGTCCCCAAGGCAGTCTATCCGACACAG
TTGTCCGAGGTCACGCGCAGTTATGACCAGGTCTTGCAAGTAGCTGGCGACGCCTCGCGAGTCTGCGTTGCAGGA
GACTCGGCTGGAGGTGCCCTGATTCTCGGTCTCCTTCAAGAAATCGGGGCCCAGGCCCAGGAGCCGGGCGGTTTG
GGCATCAGAGTGAATGCCTCATCCGTAAAGGCCGTTCCCCGCATAGCAGCTTTGATCTCGCCATGGTTGAAGCTC
CAGTCCGACACCTTCCCTGTATCCGCCATGGATTATTTGGATCAGGAAACCCTGTGGGAATATGGATTCGCGTAC
GCCGGAGAGGCCATGGTTAATCGACATCCGGCGTCACCCGGATCGTGCACCGACGACGAGCTGTGGAAAGCGGCG
GCGCCGCAGCGCGGGCACGCAACGGCATCGACGTCAAGACGCTGCGGTTCGACGGCGGAATCCATGCCTGGCCGG
TAG
Transcript >Ophcf2|01925
ATGATTCTCGGTCCCATCTCACTCTTCGACTGCCTCGTCTTCTGTCTCTTGCTGGCGCCGCAGCTGATATGGCAT
GTCGGCCTCGTTCGCACCAGCGGCGTCGTCCTCCGAGCCCTGCCCTTCCTACTGCTGCAGCTCCCTGTCGACCTG
TTCCGTCATTGGCTGTGGCTGCCTGCATCGCGCGTGCCTGCTTTTGCGCGCGAGGCGTCCCCGTTCGAGTATCTC
GTGACAAGATGCGTGCGATACGCATTCAAGTATATTCCGCCCGACGTCGCCAACACCTTCTTCTCCAAGAGTGTG
AGCCTGCCCTTCCTGCGATGGCGCATGTTGAGGCACGGCATCGTCAAGTTTCCCGTCCACTGGCATGAGTATGAG
GACGGCGCCACTGTCAGGGGCCTATGGATCAGGCATGATCCGAGCCGGTCCCCGGACATGGTCATCTATTATCTC
CACGGTGGCGGCTTCTCGATGGGCTCCTCTCATTTCTATCTCGAGTTTCTCCTGACCTGGGCCCATTTGCTCGTA
GAGGCTGGGTTCAAGAACCCTGCCATCTTCGCGCTCGACTACACTTTGGTCCCCAAGGCAGTCTATCCGACACAG
TTGTCCGAGGTCACGCGCAGTTATGACCAGGTCTTGCAAGTAGCTGGCGACGCCTCGCGAGTCTGCGTTGCAGGA
GACTCGGCTGGAGGTGCCCTGATTCTCGGTCTCCTTCAAGAAATCGGGGCCCAGGCCCAGGAGCCGGGCGGTTTG
GGCATCAGAGTGAATGCCTCATCCGTAAAGGCCGTTCCCCGCATAGCAGCTTTGATCTCGCCATGGTTGAAGCTC
CAGTCCGACACCTTCCCTGTATCCGCCATGGATTATTTGGATCAGGAAACCCTGTGGGAATATGGATTCGCGTAC
GCCGGAGAGGCCATGGTTAATCGACATCCGGCGTCACCCGGATCGTGCACCGACGACGAGCTGTGGAAAGCGGCG
GCGCCGCAGCGCGGGCACGCAACGGCATCGACGTCAAGACGCTGCGGTTCGACGGCGGAATCCATGCCTGGCCGG
TAG
Gene >Ophcf2|01925
ATGATTCTCGGTCCCATCTCACTCTTCGACTGCCTCGTCTTCTGTCTCTTGCTGGCGCCGCAGCTGATATGGCAT
GTCGGCCTCGTTCGCACCAGCGGCGTCGTCCTCCGAGCCCTGCCCTTCCTACGTAGGACCGTCGAAATCATGTCC
TCGCTGATGGCGCTGACTTCGTCGTCGTACAGTGCTGCAGCTCCCTGTCGACCTGTTCCGTCATTGGCTGTGGCT
GCCTGCATCGCGCGTGCCTGCTTTTGCGCGCGAGGCGTCCCCGTTCGAGTATCTCGTGACAAGATGCGTGCGATA
CGCATTCAAGTATATTCCGCCCGACGTCGCCAACACCTTCTTCTCCAAGAGTGTGAGCCTGCCCTTCCTGCGATG
GCGCATGTTGAGGCACGGCATCGTCAAGTTTCCCGTCCACTGGCATGAGTATGAGGTATGTGTACCTGATCAATT
GCTCGTCGCTCTCCCGACGTGTCGACTAATCAGCTGCGGCACAGGACGGCGCCACTGTCAGGGGCCTATGGATCA
GGCATGATCCGAGCCGGTCCCCGGACATGGTCATCTATTATCTCCACGGTCAGAGCTGGTGCCGTTCGAGGTCAC
CTTGAAGAAGCTGACCATCGTACAGGTGGCGGCTTCTCGATGGGCTCCTCTCATTTCTATCTCGAGTTTCTCCTG
ACCTGGGCCCATTTGCTCGTAGAGGCTGGGTTCAAGAACCCTGCCATCTTCGCGCTCGACTACACTTTGGTCCCC
AAGGCAGTCTATCCGACACAGTTGTCCGAGGTCACGCGCAGTTATGACCAGGTCTTGCAAGTAGCTGGCGACGCC
TCGCGAGTCTGCGTTGCAGGAGACTCGGCTGGAGGTGCCCTGATTCTCGGTCTCCTTCAAGAAATCGGGGCCCAG
GCCCAGGAGCCGGGCGGTTTGGGCATCAGAGTGAATGCCTCATCCGTAAAGGCCGTTCCCCGCATAGCAGCTTTG
ATCTCGCCATGGTTGAAGCTCCAGTCCGACACCTTCCCTGTATCCGCCATGGATTATTTGGATCAGGAAACCCTG
TGGGAATATGGATTCGCGTACGCCGGAGAGGCCATGGTTAATCGACATCCGGCGTCACCCGGATCGTGCACCGAC
GACGAGCTGTGGAAAGCGGCGGCGCCGCAGCGCGGGTACATCGTCCTCTTTGGTGAGGAAGAAGTGTTTGCGCCA
GACATCGAAGCCTTTATTATTTGTCAGGCACGCAACGGCATCGACGTCAAGACGCTGCGGTTCGACGGCGGAATC
CATGCCTGGCCGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail