Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01912
Gene name
Locationscaffold_02:2078862..2081043
Strand-
Gene length (bp)2181
Transcript length (bp)1080
Coding sequence length (bp)1080
Protein length (aa) 360

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00800 PDT Prephenate dehydratase 1.4E-53 65 250

GO

GO Term Description Terminal node
GO:0004664 prephenate dehydratase activity Yes
GO:0009094 L-phenylalanine biosynthetic process Yes
GO:1902223 erythrose 4-phosphate/phosphoenolpyruvate family amino acid biosynthetic process No
GO:0044283 small molecule biosynthetic process No
GO:0009095 aromatic amino acid family biosynthetic process, prephenate pathway No
GO:0003824 catalytic activity No
GO:0008652 cellular amino acid biosynthetic process No
GO:0006520 cellular amino acid metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0009073 aromatic amino acid family biosynthetic process No
GO:0009058 biosynthetic process No
GO:0044281 small molecule metabolic process No
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0009987 cellular process No
GO:0043436 oxoacid metabolic process No
GO:0016836 hydro-lyase activity No
GO:0044237 cellular metabolic process No
GO:1901605 alpha-amino acid metabolic process No
GO:0071704 organic substance metabolic process No
GO:0016829 lyase activity No
GO:0008150 biological_process No
GO:0006082 organic acid metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0046394 carboxylic acid biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:1901607 alpha-amino acid biosynthetic process No
GO:1902221 erythrose 4-phosphate/phosphoenolpyruvate family amino acid metabolic process No
GO:0016053 organic acid biosynthetic process No
GO:0016835 carbon-oxygen lyase activity No
GO:0006558 L-phenylalanine metabolic process No
GO:0003674 molecular_function No
GO:0009072 aromatic amino acid family metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.155 0.1996 0.0886 0.0829 0.8864 0.0454 0.0468 0.0633 0.0863 0.0204

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4156
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6887
Ophiocordyceps australis map64 (Brazil) OphauB2|6578
Ophiocordyceps camponoti-floridani Ophcf2|01912 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1106
Ophiocordyceps kimflemingae Ophio5|1774
Ophiocordyceps subramaniannii Hirsu2|8421

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01912
MKPTAFRLQGLWSRVFVHEYPYGYSQLRPLTASCSASRHAVCYRWKLWETRPFSSYVMASRPLKKATLQTFSEDK
WELRPATTITDVFEDVQFRQASLGVMPLENSSNGCVVETFDNLADRDGRYRDIVVQGETYIDVNHCLLGKKKTDR
PPTEAAMEPENSDLEHIKQVFSHPQALGQCRRFISLNLRGVEKHAVSSTSRAAEMVAQSEDDTKAAISSKFAAST
YSLDVLAEAIQDRSDNATRFLVIGNLLNPAQDAPAPIKSLFAGPDTRSKSLISFTVPHGSPGALADVLSCFNQQG
LNLTSINTRPSLLAPFQYVFFVEFEGHRFEDDGRVERALDNISRVAKGSRWLGSWERHR*
Coding >Ophcf2|01912
ATGAAACCAACGGCGTTTCGGCTGCAGGGGCTCTGGAGCAGAGTGTTCGTACACGAATATCCGTACGGATACAGC
CAACTTCGTCCATTAACAGCTAGTTGTTCAGCCTCGAGGCACGCAGTTTGCTACCGGTGGAAACTTTGGGAGACG
AGACCCTTTTCCTCATACGTCATGGCTTCAAGACCCCTCAAAAAGGCCACTCTTCAAACGTTTTCCGAAGACAAA
TGGGAGCTGCGTCCGGCCACAACAATCACCGACGTCTTCGAAGATGTTCAGTTCCGCCAGGCTTCACTGGGTGTC
ATGCCCCTTGAAAACTCGAGCAACGGCTGCGTCGTGGAAACTTTCGACAACTTGGCCGATAGAGATGGTCGCTAC
CGAGATATCGTCGTCCAAGGCGAAACATATATCGATGTGAACCACTGCCTCCTCGGCAAGAAGAAGACCGATCGG
CCCCCGACAGAGGCCGCAATGGAGCCCGAGAATTCCGACTTGGAGCACATTAAGCAGGTGTTTTCCCACCCGCAG
GCCTTGGGCCAGTGCAGACGTTTCATCTCCCTGAACCTCAGGGGCGTGGAAAAGCATGCCGTCAGCTCGACCAGC
AGAGCCGCCGAAATGGTAGCCCAGAGCGAAGACGACACCAAGGCCGCCATTTCCAGCAAGTTTGCGGCCAGCACC
TACAGCCTAGACGTGCTCGCCGAGGCGATTCAGGACCGCAGTGATAACGCTACGCGGTTCCTCGTCATTGGAAAT
CTGCTGAATCCCGCTCAAGATGCTCCGGCCCCCATCAAGTCGCTCTTCGCGGGACCAGACACGCGGTCCAAGTCC
CTCATCTCCTTCACCGTGCCACACGGCTCGCCTGGCGCACTGGCAGACGTCTTGAGCTGCTTTAATCAGCAGGGC
CTCAATCTGACGAGCATCAACACCCGGCCGAGCCTGCTGGCGCCGTTCCAGTACGTCTTCTTCGTCGAGTTCGAG
GGTCACAGGTTTGAAGACGACGGGAGGGTGGAGAGGGCATTGGACAATATCAGCCGCGTTGCCAAGGGCTCGAGA
TGGTTGGGAAGCTGGGAACGGCACCGTTAA
Transcript >Ophcf2|01912
ATGAAACCAACGGCGTTTCGGCTGCAGGGGCTCTGGAGCAGAGTGTTCGTACACGAATATCCGTACGGATACAGC
CAACTTCGTCCATTAACAGCTAGTTGTTCAGCCTCGAGGCACGCAGTTTGCTACCGGTGGAAACTTTGGGAGACG
AGACCCTTTTCCTCATACGTCATGGCTTCAAGACCCCTCAAAAAGGCCACTCTTCAAACGTTTTCCGAAGACAAA
TGGGAGCTGCGTCCGGCCACAACAATCACCGACGTCTTCGAAGATGTTCAGTTCCGCCAGGCTTCACTGGGTGTC
ATGCCCCTTGAAAACTCGAGCAACGGCTGCGTCGTGGAAACTTTCGACAACTTGGCCGATAGAGATGGTCGCTAC
CGAGATATCGTCGTCCAAGGCGAAACATATATCGATGTGAACCACTGCCTCCTCGGCAAGAAGAAGACCGATCGG
CCCCCGACAGAGGCCGCAATGGAGCCCGAGAATTCCGACTTGGAGCACATTAAGCAGGTGTTTTCCCACCCGCAG
GCCTTGGGCCAGTGCAGACGTTTCATCTCCCTGAACCTCAGGGGCGTGGAAAAGCATGCCGTCAGCTCGACCAGC
AGAGCCGCCGAAATGGTAGCCCAGAGCGAAGACGACACCAAGGCCGCCATTTCCAGCAAGTTTGCGGCCAGCACC
TACAGCCTAGACGTGCTCGCCGAGGCGATTCAGGACCGCAGTGATAACGCTACGCGGTTCCTCGTCATTGGAAAT
CTGCTGAATCCCGCTCAAGATGCTCCGGCCCCCATCAAGTCGCTCTTCGCGGGACCAGACACGCGGTCCAAGTCC
CTCATCTCCTTCACCGTGCCACACGGCTCGCCTGGCGCACTGGCAGACGTCTTGAGCTGCTTTAATCAGCAGGGC
CTCAATCTGACGAGCATCAACACCCGGCCGAGCCTGCTGGCGCCGTTCCAGTACGTCTTCTTCGTCGAGTTCGAG
GGTCACAGGTTTGAAGACGACGGGAGGGTGGAGAGGGCATTGGACAATATCAGCCGCGTTGCCAAGGGCTCGAGA
TGGTTGGGAAGCTGGGAACGGCACCGTTAA
Gene >Ophcf2|01912
ATGAAACCAACGGCGTTTCGGCTGCAGGGGCTCTGGAGCAGAGTGTTCGTACACGAATATCCGTACGGATACAGC
CAACTGTCAGCAGTCAGCCTATTGTCCCGCTTAGACGCGCGCACTGACTCTGCAGAGACGCAAGTCGTCCATTAA
CAGCTAGTTGTTCAGCCTCGAGGCACGCAGTTTGCTACCGGTGGAAACTTTGGGAGACGAGACCCTTTTCCTCAT
ACGTCATGGCTTCAAGGTAAGACAGAGCGCAGACGCCAACGAACGCGGAGGGTGCCAGCTGTGGCGCTCCCGCAT
GTTTCGGGGGGCCGATGAGAGCGGGATGACGCCTCTGGGATCTTCGTGGCTTGTGCAAGGCAGACGGGATACGTG
GCGTCTGCGAGCTGATGCGGCAGGACGGGTGAGGAGCAAGCAAGCAGATGCTGTGATGCGTGGTGATGGCCTCGT
TTGTGGTTTTGCGAAACTCAAAGTTTGACGGTTTCTCCGCTGAGCGCTATTCCAGGAACGTCGCCGACGGTTATA
GGTGGACACTCGTCGTCTGAGCAGTAATAGTAAATTTAAAATGGCATAACCATATGTATTCGTAGAGTAAGGAGT
CTCACACAGTATCATGGCCGAGATCGGGGCAAATCAATCGCGTGAATTCCCATGTAGACGCCTACCCTATACCTG
CCCATTTGTCAGATGCCAAGACGCAGCTGCGAAATCCTCATCCAATGAGATCAGCGAATGTCGATCGCGTAAAGC
CGTTAGTGGTCGCTCCGATAGCATTTCGCGCAACACGCTTTCACAAAGCGTGACGCGAAACCATCACCAGAAGTC
TGCTGAGCATCATCTCCAACTGGCAGGCATTTCCCCCCTCGTCAGGGCTTCTTCCGCCAGACTGACGCCTATCCC
CTGATCTACAGGTGTGATAAGGATATCAGACAAGTCTCTAGGCATCCAGGAAGCCCGTTCTCAACTGCAACTTTC
ACCCGCCATGGCTCGAGAAAAAGATATCGAAGCGGGAGGAAGTCTTCGTATCGGCCCCAAAGGCATCCAGCCTTT
CCCTTCGCGGCCCGAGACATATCCACGGACTTCGGAGAAAGCCGCCGTCGATGATGCCCAGCTAGTCAAGCCCGT
TGTCAGCTTTCTCGGCCCCATCTCCTCCTACTCGCACCAGGTGACTGTCGTATCTGCTCTCAGCCACCTTGACAC
CCGTTAACCGCCGAGACCCCTCAAAAAGGCCACTCTTCAAACGTTTTCCGAAGACAAATGGGAGCTGCGTCCGGC
CACAACAATCACCGGTAGGCGCCGATGCCGACCATCGTCGAGCTGCCTTTTCCGTCTGGCCCCTCGTCTGACGCA
GTAGTAGACGTCTTCGAAGATGTTCAGTTCCGCCAGGCTTCACTGGGTGTCATGCCCCTTGAAAACTCGAGCAAC
GGCTGCGTCGTGGAAACTTTCGACAACTTGGCCGATAGAGATGGTCGCTACCGAGATATCGTCGTCCAAGGCGAA
ACATATATCGATGTGAACCACTGCCTCCTCGGCAAGAAGAAGACCGATCGGCCCCCGACAGAGGCCGCAATGGAG
CCCGAGAATTCCGACTTGGAGCACATTAAGCAGGTGTTTTCCCACCCGCAGGCCTTGGGCCAGTGCAGACGTTTC
ATCTCCCTGAACCTCAGGGGCGTGGAAAAGCATGCCGTCAGCTCGACCAGCAGAGCCGCCGAAATGGTAGCCCAG
AGCGAAGACGACACCAAGGCCGCCATTTCCAGCAAGTTTGCGGCCAGCACCTACAGCCTAGACGTGCTCGCCGAG
GCGATTCAGGACCGCAGTGATAACGCTACGCGGTTCCTCGTCATTGGAAATCTGCTGAATCCCGCTCAAGATGCT
CCGGCCCCCATCAAGTCGCTCTTCGCGGGACCAGACACGCGGTCCAAGTCCCTCATCTCCTTCACCGTGCCACAC
GGCTCGCCTGGCGCACTGGCAGACGTCTTGAGCTGCTTTAATCAGCAGGGCCTCAATCTGACGAGCATCAACACC
CGGCCGAGCCTGCTGGCGCCGTTCCAGTACGTCTTCTTCGTCGAGTTCGAGGGTCACAGGTTTGAAGACGACGGG
AGGGTGGAGAGGGCATTGGACAATATCAGCCGCGTTGCCAAGGGCTCGAGATGGTTGGGAAGCTGGGAACGGCAC
CGTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail