Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01906
Gene name
Locationscaffold_02:2063451..2065254
Strand+
Gene length (bp)1803
Transcript length (bp)1803
Coding sequence length (bp)1803
Protein length (aa) 601

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07540 NOC3p Nucleolar complex-associated protein 1.1E-29 125 216

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.1458 0.9283 0.1415 0.0033 0.0354 0.016 0.0256 0.011 0.0755 0.0037

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3135
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1938
Ophiocordyceps australis map64 (Brazil) OphauB2|2858
Ophiocordyceps camponoti-floridani Ophcf2|01906 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2442
Ophiocordyceps kimflemingae Ophio5|531
Ophiocordyceps subramaniannii Hirsu2|5507

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01906
MSSSKRRKLEDGSSDVEAAEKISSKRAQKDFLINASNWNLEEDYALRKRKANKKNKESNRLPQIKTSEGRAEILK
SLVVDDDVVSVASDADWLEGREDHVESEPDVTDDEAEVEAEIPEAQQVLQAQEELARMALAINESPEDNVASLKA
MAKIGQSKVVTVQMLALLTQMAVYKDIIPGYRIRPHPEAAQKEKVSKEVRRLQQFEQSLVHGYQAYIRELTRCAK
AQQSLSSTAITCACELVRAVPHFNFRSDLVKILVGKLSRRTTARDADAVKCLEALEHLFREDEEGRPSFEAVSLL
AKMMRARDFKVDESVLNLFLSLRLLSEFSGKASQDRVDGQQDTSKRIKAKRQFRTKRERKAVKEQKALDKDMAQA
DALVSHEERDRMQSETLKLVFATYFRILKLRLPRLMGAVLEGLAKYARLINQDFFGDLLEALKDLIRHSDSDASS
GSGQAGDGLAADDDDDDDDDDDDDDDDDDDDDDDVAPGRNLTREALLCTVTAFALLAGQDAHNARHDLHLDLSFF
TLHLFQTLLSLATDASLEDSATPISSSPTSSSAPGFKVNVQTTTVLLLRSLTAIVLPPWNIRQVPPSDSQPSPSS
*
Coding >Ophcf2|01906
ATGTCTTCCAGCAAGAGACGCAAGTTGGAAGACGGCTCCTCTGACGTCGAGGCAGCCGAGAAAATCTCTTCTAAA
AGGGCGCAAAAGGACTTTCTCATCAATGCCTCCAACTGGAACCTTGAAGAGGACTACGCTCTTCGAAAGCGCAAA
GCCAACAAGAAGAATAAGGAAAGCAATCGGTTGCCACAGATCAAGACCTCAGAAGGGCGCGCCGAGATCCTAAAG
AGTCTCGTGGTTGACGATGACGTCGTCTCCGTTGCAAGCGACGCGGATTGGCTCGAGGGCCGCGAGGATCACGTC
GAATCCGAACCGGACGTGACGGACGACGAGGCCGAGGTCGAGGCCGAGATTCCGGAAGCGCAACAGGTGCTACAG
GCTCAGGAGGAGCTGGCGAGAATGGCGCTCGCCATCAACGAGAGTCCAGAAGATAACGTGGCCTCGCTCAAGGCC
ATGGCCAAGATCGGACAGTCCAAGGTGGTGACGGTGCAGATGCTGGCTCTCTTGACGCAGATGGCCGTCTACAAG
GATATCATCCCAGGCTACAGGATCCGACCGCATCCGGAAGCGGCGCAAAAGGAGAAGGTGTCCAAGGAGGTGCGC
CGGCTGCAGCAGTTTGAGCAGTCGCTCGTCCACGGCTACCAGGCCTACATCCGCGAGCTCACCCGATGCGCAAAG
GCGCAGCAGAGCCTATCGAGTACGGCCATCACCTGCGCCTGCGAGCTGGTCAGGGCAGTGCCGCACTTCAACTTC
CGCTCCGACCTGGTCAAGATTCTCGTCGGCAAGCTAAGCCGGAGGACGACGGCGCGGGATGCAGATGCCGTCAAG
TGTCTCGAGGCGCTGGAGCATCTATTCCGGGAAGATGAGGAGGGGAGGCCGTCGTTTGAGGCTGTCTCGCTGTTG
GCCAAGATGATGCGGGCGCGTGACTTTAAGGTGGACGAGTCGGTGCTCAACCTCTTCCTCAGTCTACGACTGCTA
TCCGAGTTCTCCGGAAAGGCTTCTCAGGACAGGGTCGACGGTCAGCAAGACACGAGCAAGAGAATCAAGGCCAAG
CGTCAGTTCCGGACCAAGAGAGAGAGGAAAGCAGTCAAGGAGCAAAAGGCGCTCGACAAGGACATGGCCCAGGCA
GACGCGCTCGTCAGCCACGAGGAGCGCGACAGGATGCAGTCCGAGACACTCAAGCTCGTCTTCGCCACCTACTTT
CGCATCCTCAAACTTCGACTGCCTCGTCTCATGGGCGCTGTGCTCGAGGGCCTGGCCAAGTACGCTCGTCTCATC
AACCAGGACTTCTTTGGCGATCTGCTCGAGGCTCTCAAGGACCTCATCCGTCACAGCGATAGCGACGCCAGCTCC
GGTTCGGGTCAGGCTGGTGATGGTCTCGCTGCTGATGATGATGACGACGACGACGACGACGACGACGACGACGAC
GACGACGACGACGACGACGACGACGACGTTGCGCCCGGACGGAACCTCACGCGTGAGGCTCTTCTCTGCACCGTC
ACGGCTTTCGCCCTCCTCGCCGGTCAAGATGCTCACAACGCCCGTCACGACCTCCATCTTGACCTCTCCTTCTTC
ACCCTCCACCTCTTCCAAACACTCCTCTCTCTCGCCACAGACGCAAGCCTCGAGGACTCCGCCACGCCAATCTCA
TCCTCTCCCACATCCTCTTCCGCCCCAGGCTTCAAAGTCAACGTGCAGACGACGACGGTGCTCCTCCTCCGCTCG
CTAACAGCCATCGTCCTCCCCCCCTGGAACATCCGCCAAGTCCCCCCCTCCGACTCGCAGCCTTCACCAAGCAGC
TGA
Transcript >Ophcf2|01906
ATGTCTTCCAGCAAGAGACGCAAGTTGGAAGACGGCTCCTCTGACGTCGAGGCAGCCGAGAAAATCTCTTCTAAA
AGGGCGCAAAAGGACTTTCTCATCAATGCCTCCAACTGGAACCTTGAAGAGGACTACGCTCTTCGAAAGCGCAAA
GCCAACAAGAAGAATAAGGAAAGCAATCGGTTGCCACAGATCAAGACCTCAGAAGGGCGCGCCGAGATCCTAAAG
AGTCTCGTGGTTGACGATGACGTCGTCTCCGTTGCAAGCGACGCGGATTGGCTCGAGGGCCGCGAGGATCACGTC
GAATCCGAACCGGACGTGACGGACGACGAGGCCGAGGTCGAGGCCGAGATTCCGGAAGCGCAACAGGTGCTACAG
GCTCAGGAGGAGCTGGCGAGAATGGCGCTCGCCATCAACGAGAGTCCAGAAGATAACGTGGCCTCGCTCAAGGCC
ATGGCCAAGATCGGACAGTCCAAGGTGGTGACGGTGCAGATGCTGGCTCTCTTGACGCAGATGGCCGTCTACAAG
GATATCATCCCAGGCTACAGGATCCGACCGCATCCGGAAGCGGCGCAAAAGGAGAAGGTGTCCAAGGAGGTGCGC
CGGCTGCAGCAGTTTGAGCAGTCGCTCGTCCACGGCTACCAGGCCTACATCCGCGAGCTCACCCGATGCGCAAAG
GCGCAGCAGAGCCTATCGAGTACGGCCATCACCTGCGCCTGCGAGCTGGTCAGGGCAGTGCCGCACTTCAACTTC
CGCTCCGACCTGGTCAAGATTCTCGTCGGCAAGCTAAGCCGGAGGACGACGGCGCGGGATGCAGATGCCGTCAAG
TGTCTCGAGGCGCTGGAGCATCTATTCCGGGAAGATGAGGAGGGGAGGCCGTCGTTTGAGGCTGTCTCGCTGTTG
GCCAAGATGATGCGGGCGCGTGACTTTAAGGTGGACGAGTCGGTGCTCAACCTCTTCCTCAGTCTACGACTGCTA
TCCGAGTTCTCCGGAAAGGCTTCTCAGGACAGGGTCGACGGTCAGCAAGACACGAGCAAGAGAATCAAGGCCAAG
CGTCAGTTCCGGACCAAGAGAGAGAGGAAAGCAGTCAAGGAGCAAAAGGCGCTCGACAAGGACATGGCCCAGGCA
GACGCGCTCGTCAGCCACGAGGAGCGCGACAGGATGCAGTCCGAGACACTCAAGCTCGTCTTCGCCACCTACTTT
CGCATCCTCAAACTTCGACTGCCTCGTCTCATGGGCGCTGTGCTCGAGGGCCTGGCCAAGTACGCTCGTCTCATC
AACCAGGACTTCTTTGGCGATCTGCTCGAGGCTCTCAAGGACCTCATCCGTCACAGCGATAGCGACGCCAGCTCC
GGTTCGGGTCAGGCTGGTGATGGTCTCGCTGCTGATGATGATGACGACGACGACGACGACGACGACGACGACGAC
GACGACGACGACGACGACGACGACGACGTTGCGCCCGGACGGAACCTCACGCGTGAGGCTCTTCTCTGCACCGTC
ACGGCTTTCGCCCTCCTCGCCGGTCAAGATGCTCACAACGCCCGTCACGACCTCCATCTTGACCTCTCCTTCTTC
ACCCTCCACCTCTTCCAAACACTCCTCTCTCTCGCCACAGACGCAAGCCTCGAGGACTCCGCCACGCCAATCTCA
TCCTCTCCCACATCCTCTTCCGCCCCAGGCTTCAAAGTCAACGTGCAGACGACGACGGTGCTCCTCCTCCGCTCG
CTAACAGCCATCGTCCTCCCCCCCTGGAACATCCGCCAAGTCCCCCCCTCCGACTCGCAGCCTTCACCAAGCAGC
TGA
Gene >Ophcf2|01906
ATGTCTTCCAGCAAGAGACGCAAGTTGGAAGACGGCTCCTCTGACGTCGAGGCAGCCGAGAAAATCTCTTCTAAA
AGGGCGCAAAAGGACTTTCTCATCAATGCCTCCAACTGGAACCTTGAAGAGGACTACGCTCTTCGAAAGCGCAAA
GCCAACAAGAAGAATAAGGAAAGCAATCGGTTGCCACAGATCAAGACCTCAGAAGGGCGCGCCGAGATCCTAAAG
AGTCTCGTGGTTGACGATGACGTCGTCTCCGTTGCAAGCGACGCGGATTGGCTCGAGGGCCGCGAGGATCACGTC
GAATCCGAACCGGACGTGACGGACGACGAGGCCGAGGTCGAGGCCGAGATTCCGGAAGCGCAACAGGTGCTACAG
GCTCAGGAGGAGCTGGCGAGAATGGCGCTCGCCATCAACGAGAGTCCAGAAGATAACGTGGCCTCGCTCAAGGCC
ATGGCCAAGATCGGACAGTCCAAGGTGGTGACGGTGCAGATGCTGGCTCTCTTGACGCAGATGGCCGTCTACAAG
GATATCATCCCAGGCTACAGGATCCGACCGCATCCGGAAGCGGCGCAAAAGGAGAAGGTGTCCAAGGAGGTGCGC
CGGCTGCAGCAGTTTGAGCAGTCGCTCGTCCACGGCTACCAGGCCTACATCCGCGAGCTCACCCGATGCGCAAAG
GCGCAGCAGAGCCTATCGAGTACGGCCATCACCTGCGCCTGCGAGCTGGTCAGGGCAGTGCCGCACTTCAACTTC
CGCTCCGACCTGGTCAAGATTCTCGTCGGCAAGCTAAGCCGGAGGACGACGGCGCGGGATGCAGATGCCGTCAAG
TGTCTCGAGGCGCTGGAGCATCTATTCCGGGAAGATGAGGAGGGGAGGCCGTCGTTTGAGGCTGTCTCGCTGTTG
GCCAAGATGATGCGGGCGCGTGACTTTAAGGTGGACGAGTCGGTGCTCAACCTCTTCCTCAGTCTACGACTGCTA
TCCGAGTTCTCCGGAAAGGCTTCTCAGGACAGGGTCGACGGTCAGCAAGACACGAGCAAGAGAATCAAGGCCAAG
CGTCAGTTCCGGACCAAGAGAGAGAGGAAAGCAGTCAAGGAGCAAAAGGCGCTCGACAAGGACATGGCCCAGGCA
GACGCGCTCGTCAGCCACGAGGAGCGCGACAGGATGCAGTCCGAGACACTCAAGCTCGTCTTCGCCACCTACTTT
CGCATCCTCAAACTTCGACTGCCTCGTCTCATGGGCGCTGTGCTCGAGGGCCTGGCCAAGTACGCTCGTCTCATC
AACCAGGACTTCTTTGGCGATCTGCTCGAGGCTCTCAAGGACCTCATCCGTCACAGCGATAGCGACGCCAGCTCC
GGTTCGGGTCAGGCTGGTGATGGTCTCGCTGCTGATGATGATGACGACGACGACGACGACGACGACGACGACGAC
GACGACGACGACGACGACGACGACGACGTTGCGCCCGGACGGAACCTCACGCGTGAGGCTCTTCTCTGCACCGTC
ACGGCTTTCGCCCTCCTCGCCGGTCAAGATGCTCACAACGCCCGTCACGACCTCCATCTTGACCTCTCCTTCTTC
ACCCTCCACCTCTTCCAAACACTCCTCTCTCTCGCCACAGACGCAAGCCTCGAGGACTCCGCCACGCCAATCTCA
TCCTCTCCCACATCCTCTTCCGCCCCAGGCTTCAAAGTCAACGTGCAGACGACGACGGTGCTCCTCCTCCGCTCG
CTAACAGCCATCGTCCTCCCCCCCTGGAACATCCGCCAAGTCCCCCCCTCCGACTCGCAGCCTTCACCAAGCAGC
TGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail