Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01900
Gene name
Locationscaffold_02:2047419..2048883
Strand-
Gene length (bp)1464
Transcript length (bp)1404
Coding sequence length (bp)1404
Protein length (aa) 468

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00026 Asp Eukaryotic aspartyl protease 3.2E-55 55 399

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

Domain # Start End Length
1 444 466 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 11.11 4.58 17.64
Alive In ants, during behavior modification 41.49 17.07 65.91
Dead In ants, recently dead 22.81 10.59 35.03

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.004376 yes
Dead Fungus 0.002117 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01900
MRSFALLLVGWWVASGAGEEAKVLKINVRRGIVEQSALQRRDTLNSTLRNRIGLYTIDIGIGNPPQQISALIDTG
SSDALINTNVSQLCEQKSRPCAPSGTYNANASSTSQYINNLFNISYVDGSGAGGDFVADDVRISGKQVKGAQLGV
AYRSSSPQSVLGIGLASNEALAAKGRRKGGDGSGEYVNLPAKMVQDGVISSNSYSLWLNDIDSPEGSILFGGVDT
ARFQEPLVSMPMQKVDGRFSEFFITMTGLQLDNSSLASNLRLAVLLDSGSTFTYLPDKVAQSVYSSLNARFDSQS
GAAFVPCSLAKQSRSLRFDFTSPASVTVPVSELVIRPEKLSAKPVSFGNGVPACYLGIMPTSGSGGGAGSSTASV
LGDTFLRSAYVVYDLQGHTIALANTVYNATGSDIKEIPSDGKIPGAVEARDPVRATSGIPGQRSGAAGGGTAASP
FAAVVLGVVVSVMICWS*
Coding >Ophcf2|01900
ATGAGGTCTTTTGCTCTTCTTCTGGTGGGCTGGTGGGTGGCCTCTGGGGCTGGGGAGGAGGCCAAGGTGTTGAAG
ATTAATGTTCGGAGGGGGATTGTTGAGCAGTCTGCTTTGCAGAGGAGGGATACGCTCAACTCGACGCTGAGGAAT
AGGATCGGACTCTACACCATCGACATTGGCATCGGAAACCCCCCCCAACAAATCTCCGCCCTCATCGACACCGGA
AGCAGCGACGCCCTGATAAACACAAACGTCTCGCAACTCTGCGAGCAGAAATCCCGCCCCTGCGCCCCATCAGGA
ACCTACAACGCCAACGCATCCTCAACATCCCAGTATATAAACAACCTCTTCAACATCTCCTACGTCGACGGTTCC
GGCGCCGGAGGCGACTTCGTGGCTGACGACGTGCGCATCTCTGGGAAGCAGGTCAAGGGCGCGCAGCTGGGGGTC
GCCTATCGGAGTTCGTCGCCGCAGTCCGTCTTGGGGATCGGTTTGGCTTCTAACGAGGCTTTGGCGGCCAAGGGG
AGGAGGAAAGGAGGTGATGGGTCGGGGGAATACGTCAACTTGCCGGCCAAGATGGTTCAGGACGGCGTCATCTCA
TCCAATTCATATAGCCTCTGGCTCAACGACATCGATTCGCCTGAAGGGTCCATCCTCTTCGGTGGCGTCGATACA
GCCCGCTTCCAAGAACCACTGGTCAGCATGCCCATGCAGAAAGTCGATGGCCGCTTCTCCGAATTCTTCATCACC
ATGACAGGCCTTCAGCTCGACAACAGCTCCCTAGCATCAAACCTCCGCCTCGCCGTCCTCCTCGACTCAGGCTCA
ACGTTCACATACCTCCCCGATAAAGTCGCCCAGTCGGTATACTCGAGTCTCAACGCCCGCTTCGATAGCCAGTCG
GGCGCCGCCTTCGTCCCTTGCTCGCTGGCAAAGCAGTCGCGATCCCTACGCTTCGACTTCACCAGTCCAGCCTCC
GTGACGGTTCCCGTAAGTGAACTCGTCATTCGGCCCGAGAAACTGTCTGCCAAACCTGTCAGCTTCGGGAATGGT
GTTCCGGCTTGTTACCTTGGAATCATGCCCACCAGCGGCAGCGGAGGCGGCGCAGGGAGCAGCACGGCCAGCGTA
CTGGGAGATACCTTCCTGCGCAGCGCATACGTCGTCTATGATCTTCAGGGACATACTATTGCGCTGGCAAACACG
GTATACAACGCCACGGGGTCTGATATCAAGGAGATTCCCTCGGACGGTAAGATCCCCGGCGCTGTCGAAGCCCGC
GATCCTGTACGTGCTACTTCGGGAATTCCGGGCCAGAGATCGGGGGCTGCTGGTGGGGGGACGGCCGCGTCTCCG
TTTGCGGCTGTTGTGCTGGGTGTTGTTGTCAGCGTGATGATTTGCTGGTCCTGA
Transcript >Ophcf2|01900
ATGAGGTCTTTTGCTCTTCTTCTGGTGGGCTGGTGGGTGGCCTCTGGGGCTGGGGAGGAGGCCAAGGTGTTGAAG
ATTAATGTTCGGAGGGGGATTGTTGAGCAGTCTGCTTTGCAGAGGAGGGATACGCTCAACTCGACGCTGAGGAAT
AGGATCGGACTCTACACCATCGACATTGGCATCGGAAACCCCCCCCAACAAATCTCCGCCCTCATCGACACCGGA
AGCAGCGACGCCCTGATAAACACAAACGTCTCGCAACTCTGCGAGCAGAAATCCCGCCCCTGCGCCCCATCAGGA
ACCTACAACGCCAACGCATCCTCAACATCCCAGTATATAAACAACCTCTTCAACATCTCCTACGTCGACGGTTCC
GGCGCCGGAGGCGACTTCGTGGCTGACGACGTGCGCATCTCTGGGAAGCAGGTCAAGGGCGCGCAGCTGGGGGTC
GCCTATCGGAGTTCGTCGCCGCAGTCCGTCTTGGGGATCGGTTTGGCTTCTAACGAGGCTTTGGCGGCCAAGGGG
AGGAGGAAAGGAGGTGATGGGTCGGGGGAATACGTCAACTTGCCGGCCAAGATGGTTCAGGACGGCGTCATCTCA
TCCAATTCATATAGCCTCTGGCTCAACGACATCGATTCGCCTGAAGGGTCCATCCTCTTCGGTGGCGTCGATACA
GCCCGCTTCCAAGAACCACTGGTCAGCATGCCCATGCAGAAAGTCGATGGCCGCTTCTCCGAATTCTTCATCACC
ATGACAGGCCTTCAGCTCGACAACAGCTCCCTAGCATCAAACCTCCGCCTCGCCGTCCTCCTCGACTCAGGCTCA
ACGTTCACATACCTCCCCGATAAAGTCGCCCAGTCGGTATACTCGAGTCTCAACGCCCGCTTCGATAGCCAGTCG
GGCGCCGCCTTCGTCCCTTGCTCGCTGGCAAAGCAGTCGCGATCCCTACGCTTCGACTTCACCAGTCCAGCCTCC
GTGACGGTTCCCGTAAGTGAACTCGTCATTCGGCCCGAGAAACTGTCTGCCAAACCTGTCAGCTTCGGGAATGGT
GTTCCGGCTTGTTACCTTGGAATCATGCCCACCAGCGGCAGCGGAGGCGGCGCAGGGAGCAGCACGGCCAGCGTA
CTGGGAGATACCTTCCTGCGCAGCGCATACGTCGTCTATGATCTTCAGGGACATACTATTGCGCTGGCAAACACG
GTATACAACGCCACGGGGTCTGATATCAAGGAGATTCCCTCGGACGGTAAGATCCCCGGCGCTGTCGAAGCCCGC
GATCCTGTACGTGCTACTTCGGGAATTCCGGGCCAGAGATCGGGGGCTGCTGGTGGGGGGACGGCCGCGTCTCCG
TTTGCGGCTGTTGTGCTGGGTGTTGTTGTCAGCGTGATGATTTGCTGGTCCTGA
Gene >Ophcf2|01900
ATGAGGTCTTTTGCTCTTCTTCTGGTGGGCTGGTGGGTGGCCTCTGGGGCTGGGGAGGAGGCCAAGGTGTTGAAG
ATTAATGTTCGGAGGGGGATTGTTGAGCAGTCTGCTTTGCAGAGGAGGGATACGCTCAACTCGACGCTGAGGAAT
AGGGTGAGTATATCCCTCTTCGAGTTTCTGAAGAGTAACCACTGACGAAGCCATTCCATTCAGATCGGACTCTAC
ACCATCGACATTGGCATCGGAAACCCCCCCCAACAAATCTCCGCCCTCATCGACACCGGAAGCAGCGACGCCCTG
ATAAACACAAACGTCTCGCAACTCTGCGAGCAGAAATCCCGCCCCTGCGCCCCATCAGGAACCTACAACGCCAAC
GCATCCTCAACATCCCAGTATATAAACAACCTCTTCAACATCTCCTACGTCGACGGTTCCGGCGCCGGAGGCGAC
TTCGTGGCTGACGACGTGCGCATCTCTGGGAAGCAGGTCAAGGGCGCGCAGCTGGGGGTCGCCTATCGGAGTTCG
TCGCCGCAGTCCGTCTTGGGGATCGGTTTGGCTTCTAACGAGGCTTTGGCGGCCAAGGGGAGGAGGAAAGGAGGT
GATGGGTCGGGGGAATACGTCAACTTGCCGGCCAAGATGGTTCAGGACGGCGTCATCTCATCCAATTCATATAGC
CTCTGGCTCAACGACATCGATTCGCCTGAAGGGTCCATCCTCTTCGGTGGCGTCGATACAGCCCGCTTCCAAGAA
CCACTGGTCAGCATGCCCATGCAGAAAGTCGATGGCCGCTTCTCCGAATTCTTCATCACCATGACAGGCCTTCAG
CTCGACAACAGCTCCCTAGCATCAAACCTCCGCCTCGCCGTCCTCCTCGACTCAGGCTCAACGTTCACATACCTC
CCCGATAAAGTCGCCCAGTCGGTATACTCGAGTCTCAACGCCCGCTTCGATAGCCAGTCGGGCGCCGCCTTCGTC
CCTTGCTCGCTGGCAAAGCAGTCGCGATCCCTACGCTTCGACTTCACCAGTCCAGCCTCCGTGACGGTTCCCGTA
AGTGAACTCGTCATTCGGCCCGAGAAACTGTCTGCCAAACCTGTCAGCTTCGGGAATGGTGTTCCGGCTTGTTAC
CTTGGAATCATGCCCACCAGCGGCAGCGGAGGCGGCGCAGGGAGCAGCACGGCCAGCGTACTGGGAGATACCTTC
CTGCGCAGCGCATACGTCGTCTATGATCTTCAGGGACATACTATTGCGCTGGCAAACACGGTATACAACGCCACG
GGGTCTGATATCAAGGAGATTCCCTCGGACGGTAAGATCCCCGGCGCTGTCGAAGCCCGCGATCCTGTACGTGCT
ACTTCGGGAATTCCGGGCCAGAGATCGGGGGCTGCTGGTGGGGGGACGGCCGCGTCTCCGTTTGCGGCTGTTGTG
CTGGGTGTTGTTGTCAGCGTGATGATTTGCTGGTCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail