Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01873
Gene name
Locationscaffold_02:1967884..1970466
Strand+
Gene length (bp)2582
Transcript length (bp)2235
Coding sequence length (bp)2235
Protein length (aa) 745

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12896 ANAPC4 Anaphase-promoting complex, cyclosome, subunit 4 1.1E-67 264 463
PF12894 ANAPC4_WD40 Anaphase-promoting complex subunit 4 WD40 domain 4.9E-10 27 118

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear export signal 0.4868 0.692 0.1007 0.0392 0.0368 0.0065 0.2178 0.1984 0.2819 0.0043

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5019
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|543
Ophiocordyceps australis map64 (Brazil) OphauB2|6932
Ophiocordyceps camponoti-floridani Ophcf2|01873 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4128
Ophiocordyceps kimflemingae Ophio5|8218
Ophiocordyceps subramaniannii Hirsu2|2541

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01873
MAQAKQLVLISETELDSRAPRGFPVGCPTLDVALTWDSGSSSLVVYRPPGQVISKVHQLAGAQGEAAPEAVTATW
SPDGQFLAVGWSDGIVRLIRLENNKVAHRIQGTGAQITHIGWTGSNMPKPASTSATNFPTGNGGLPLNLPQALTF
LDVDSALPKISPLPSGSSGADEDANVFTLRASVDFLFQPLKQEDHDTVNVMVVGTSDGKVQLSIYNSFVIGTFQC
PTGGDPNVSQLVHHASHPDVSTHALILADDLSETREVQVLPLDLPFVSSSQINLSLLASKLTTLQKLLRYLKQTQ
LHMQVEWRNARELPARFLRSIQADLADLQSGPRGIVPALYHVVVTGHAYEPVREWLVDTIADRGHKRWEKAVVSG
LENLRSLVHENFLPALERCALILSRLRGLAQFHDDRDDIGFSVSQISRVLDIISCLHLAGHKILVHVMDELEHFA
AFSVWLRFQIDGLTGPASQELTEREATMDTSRVLTYIETYLTSSPLDMFFDGISTKDFAADWDHCEDGPSLLQML
DTQLKKREDGQSSMRALPHVDFLVNYMTTWCDRIFKSVAERMEMSVRFGMPIKLSVGAPISKMDVRVGEAAKGGV
IYTAVACRNSESKVYILRAEMDIAGGISRNLPATGCCIDLANRQLIDTRFLNDETLIVLCKENDLTSAALSIPVQ
SSELPYAPLGAGGLESVNVIPAHGFVKYVLPEQQAARMEVHDKSEVKGQIPPRICLLSNDGTRWRTYSM*
Coding >Ophcf2|01873
ATGGCCCAGGCGAAGCAGCTCGTGCTCATCAGCGAGACAGAGCTCGACTCTCGAGCTCCTCGCGGCTTCCCCGTC
GGCTGCCCGACACTGGACGTGGCCTTGACGTGGGACAGCGGCAGCAGTAGCCTTGTCGTCTATAGGCCTCCAGGC
CAAGTGATATCCAAGGTGCACCAGTTAGCCGGTGCCCAAGGAGAAGCGGCACCGGAAGCTGTGACAGCGACTTGG
AGCCCAGACGGGCAGTTCCTGGCCGTGGGCTGGAGCGATGGCATCGTCCGGCTTATAAGACTAGAGAATAACAAG
GTCGCCCATCGCATCCAGGGAACAGGAGCACAAATCACACATATCGGCTGGACAGGCAGCAACATGCCCAAGCCG
GCGTCTACTTCAGCCACCAACTTTCCCACGGGCAACGGCGGGCTTCCTCTCAACCTCCCTCAGGCGCTGACTTTT
CTCGACGTTGACTCTGCCTTGCCCAAGATAAGTCCTCTGCCAAGCGGCAGTTCTGGCGCCGATGAGGATGCCAAC
GTCTTTACTCTCCGGGCCAGCGTCGACTTCCTCTTCCAGCCCCTAAAGCAGGAAGACCATGATACCGTCAACGTC
ATGGTGGTTGGAACCAGCGACGGCAAGGTGCAGTTGAGCATCTACAATTCCTTCGTCATCGGGACGTTTCAGTGC
CCGACAGGGGGCGACCCCAACGTATCCCAGCTAGTCCACCATGCATCGCATCCCGACGTCTCGACCCACGCGCTT
ATCTTGGCAGACGACTTGTCGGAGACGCGCGAGGTTCAAGTGCTGCCCCTGGATCTACCCTTTGTCTCATCTTCG
CAAATCAACTTGTCCCTCCTCGCGTCCAAGTTGACTACGCTGCAGAAGCTGCTGCGGTACCTGAAGCAGACGCAG
CTGCATATGCAGGTCGAATGGCGGAACGCGAGGGAGTTGCCGGCTCGCTTCCTGAGAAGCATCCAGGCCGACCTT
GCGGACTTGCAAAGCGGACCGCGAGGCATCGTTCCGGCCTTGTATCATGTGGTTGTGACGGGCCATGCCTATGAA
CCGGTCCGCGAATGGCTCGTAGACACTATTGCAGACAGAGGTCATAAACGCTGGGAAAAGGCGGTAGTTTCCGGT
CTGGAGAATCTACGCAGCCTCGTCCATGAAAACTTCCTCCCGGCCCTCGAGCGTTGCGCTCTCATACTCAGCCGG
CTTCGAGGGCTCGCCCAGTTTCACGACGACCGCGATGACATTGGCTTCTCCGTTTCCCAGATCAGCCGCGTCTTG
GACATCATCAGCTGTCTGCACCTCGCTGGCCACAAGATTCTCGTCCACGTCATGGACGAGCTGGAGCACTTTGCA
GCCTTTTCAGTCTGGTTACGTTTCCAGATCGACGGCTTGACCGGCCCAGCGAGCCAAGAACTCACGGAGAGAGAG
GCCACGATGGACACGTCCAGAGTCCTTACGTACATCGAGACTTACCTCACCTCGAGCCCGCTCGACATGTTCTTC
GACGGCATCTCGACAAAGGACTTTGCGGCTGACTGGGATCATTGCGAGGACGGACCGAGTCTGCTGCAGATGCTG
GATACACAGCTTAAGAAGCGGGAAGATGGCCAGTCGAGCATGAGGGCGCTTCCCCACGTTGACTTTCTCGTCAAC
TACATGACGACGTGGTGCGACAGGATCTTCAAGAGCGTCGCCGAACGCATGGAGATGAGTGTACGATTCGGAATG
CCCATCAAGCTTTCGGTTGGAGCCCCGATCAGCAAGATGGACGTTAGAGTCGGCGAGGCTGCAAAGGGAGGCGTC
ATCTACACCGCCGTCGCGTGCAGAAACAGCGAGAGCAAAGTGTACATCTTGCGCGCTGAGATGGACATCGCCGGC
GGCATCAGCCGCAATCTGCCGGCGACGGGCTGCTGCATCGACCTAGCCAACCGCCAGCTTATCGACACCAGATTC
CTCAACGACGAGACACTCATCGTGCTGTGCAAAGAAAACGACCTAACTTCGGCCGCGCTGTCCATACCGGTCCAG
TCAAGTGAATTACCATATGCTCCGTTGGGCGCCGGAGGGCTGGAAAGCGTCAACGTGATCCCAGCACATGGCTTT
GTCAAATATGTGCTACCCGAACAGCAAGCGGCGAGGATGGAGGTACACGACAAGAGCGAAGTCAAGGGGCAGATT
CCCCCGAGGATATGTCTCCTCAGCAACGACGGGACCAGATGGCGAACGTACTCGATGTGA
Transcript >Ophcf2|01873
ATGGCCCAGGCGAAGCAGCTCGTGCTCATCAGCGAGACAGAGCTCGACTCTCGAGCTCCTCGCGGCTTCCCCGTC
GGCTGCCCGACACTGGACGTGGCCTTGACGTGGGACAGCGGCAGCAGTAGCCTTGTCGTCTATAGGCCTCCAGGC
CAAGTGATATCCAAGGTGCACCAGTTAGCCGGTGCCCAAGGAGAAGCGGCACCGGAAGCTGTGACAGCGACTTGG
AGCCCAGACGGGCAGTTCCTGGCCGTGGGCTGGAGCGATGGCATCGTCCGGCTTATAAGACTAGAGAATAACAAG
GTCGCCCATCGCATCCAGGGAACAGGAGCACAAATCACACATATCGGCTGGACAGGCAGCAACATGCCCAAGCCG
GCGTCTACTTCAGCCACCAACTTTCCCACGGGCAACGGCGGGCTTCCTCTCAACCTCCCTCAGGCGCTGACTTTT
CTCGACGTTGACTCTGCCTTGCCCAAGATAAGTCCTCTGCCAAGCGGCAGTTCTGGCGCCGATGAGGATGCCAAC
GTCTTTACTCTCCGGGCCAGCGTCGACTTCCTCTTCCAGCCCCTAAAGCAGGAAGACCATGATACCGTCAACGTC
ATGGTGGTTGGAACCAGCGACGGCAAGGTGCAGTTGAGCATCTACAATTCCTTCGTCATCGGGACGTTTCAGTGC
CCGACAGGGGGCGACCCCAACGTATCCCAGCTAGTCCACCATGCATCGCATCCCGACGTCTCGACCCACGCGCTT
ATCTTGGCAGACGACTTGTCGGAGACGCGCGAGGTTCAAGTGCTGCCCCTGGATCTACCCTTTGTCTCATCTTCG
CAAATCAACTTGTCCCTCCTCGCGTCCAAGTTGACTACGCTGCAGAAGCTGCTGCGGTACCTGAAGCAGACGCAG
CTGCATATGCAGGTCGAATGGCGGAACGCGAGGGAGTTGCCGGCTCGCTTCCTGAGAAGCATCCAGGCCGACCTT
GCGGACTTGCAAAGCGGACCGCGAGGCATCGTTCCGGCCTTGTATCATGTGGTTGTGACGGGCCATGCCTATGAA
CCGGTCCGCGAATGGCTCGTAGACACTATTGCAGACAGAGGTCATAAACGCTGGGAAAAGGCGGTAGTTTCCGGT
CTGGAGAATCTACGCAGCCTCGTCCATGAAAACTTCCTCCCGGCCCTCGAGCGTTGCGCTCTCATACTCAGCCGG
CTTCGAGGGCTCGCCCAGTTTCACGACGACCGCGATGACATTGGCTTCTCCGTTTCCCAGATCAGCCGCGTCTTG
GACATCATCAGCTGTCTGCACCTCGCTGGCCACAAGATTCTCGTCCACGTCATGGACGAGCTGGAGCACTTTGCA
GCCTTTTCAGTCTGGTTACGTTTCCAGATCGACGGCTTGACCGGCCCAGCGAGCCAAGAACTCACGGAGAGAGAG
GCCACGATGGACACGTCCAGAGTCCTTACGTACATCGAGACTTACCTCACCTCGAGCCCGCTCGACATGTTCTTC
GACGGCATCTCGACAAAGGACTTTGCGGCTGACTGGGATCATTGCGAGGACGGACCGAGTCTGCTGCAGATGCTG
GATACACAGCTTAAGAAGCGGGAAGATGGCCAGTCGAGCATGAGGGCGCTTCCCCACGTTGACTTTCTCGTCAAC
TACATGACGACGTGGTGCGACAGGATCTTCAAGAGCGTCGCCGAACGCATGGAGATGAGTGTACGATTCGGAATG
CCCATCAAGCTTTCGGTTGGAGCCCCGATCAGCAAGATGGACGTTAGAGTCGGCGAGGCTGCAAAGGGAGGCGTC
ATCTACACCGCCGTCGCGTGCAGAAACAGCGAGAGCAAAGTGTACATCTTGCGCGCTGAGATGGACATCGCCGGC
GGCATCAGCCGCAATCTGCCGGCGACGGGCTGCTGCATCGACCTAGCCAACCGCCAGCTTATCGACACCAGATTC
CTCAACGACGAGACACTCATCGTGCTGTGCAAAGAAAACGACCTAACTTCGGCCGCGCTGTCCATACCGGTCCAG
TCAAGTGAATTACCATATGCTCCGTTGGGCGCCGGAGGGCTGGAAAGCGTCAACGTGATCCCAGCACATGGCTTT
GTCAAATATGTGCTACCCGAACAGCAAGCGGCGAGGATGGAGGTACACGACAAGAGCGAAGTCAAGGGGCAGATT
CCCCCGAGGATATGTCTCCTCAGCAACGACGGGACCAGATGGCGAACGTACTCGATGTGA
Gene >Ophcf2|01873
ATGGCCCAGGCGAAGCAGCTCGTGCTCATCAGCGAGACAGAGCTCGACTCTCGAGCTCCTCGCGGCTTCCCCGTC
GGCTGCCCGACACTGGACGTGGCCTTGACGTGGGACAGCGGCAGCAGTAGCCTTGTCGTCTATAGGCCTCCAGGC
CAAGTGATATCCAAGGTGCACCAGTTAGCCGGTGCCCAAGGAGAAGCGGCACCGGAAGCTGTGACAGCGACTTGG
AGCCCAGACGGTTCGTTTGGCCGCTAGACGACCCGTAACGAGATGCCTGACAGCGCAGGCCTTTAGGGCAGTTCC
TGGCCGTGGGCTGGAGCGATGGCATCGTCCGGCTTATAAGACTAGAGAATAACAAGGTCGCCCATCGCATCCAGG
GAACAGGAGCACAAATCACACATATCGGCTGGACAGGCAGCAACATGCCCAAGCCGGCGTCTACTTCAGCCACCA
ACTTTCCCACGGGCAACGGCGGGCTTCCTCTCAACCTCCCTCAGGCGCTGACTTTTCTCGACGTTGACTCTGCCT
TGCCCAAGATAAGTCCTCTGCCAAGCGGCAGTTCTGGCGCCGAGTAAGCTCCCAGAATGAGCTTTCAACTCACTG
GTAGAAACGCTGACCTGACCCATGATGTCAGTGAGGATGCCAACGTCTTTACTCTCCGGGCCAGCGTCGACTTCC
TCTTCCAGCCCCTAAAGCAGGAAGACCATGATACCGTCAACGTCATGGTGGTTGGAACCAGCGACGGCAAGGTGC
AGTTGAGCATCTACAATTCCTTCGTCATCGGGACGTTTCAGTGCCCGACAGGGGGCGACCCCAACGTATCCCAGC
TAGTCCACCATGCATCGCATCCCGACGTCTCGACCCACGCGCTTATCTTGGCAGACGACTTGTCGGAGACGCGCG
AGGTTCAAGTGCTGCCCCTGGATCTACCCTTTGTCTCATCTTCGCAAATCAACTTGTCCCTCCTCGCGTCCAAGT
TGACTACGCTGCAGAAGCTGCTGCGGTACCTGAAGCAGACGCAGCTGCATATGCAGGTCGAATGGCGGAACGCGA
GGGAGTTGCCGGCTCGCTTCCTGAGAAGCATCCAGGCCGACCTTGCGGACTTGCAAAGCGGACCGCGAGGCATCG
TTCCGGCCTTGTATCATGTGGTTGTGACGGGCCATGCCTATGAACCGGTCCGCGAATGGCTCGTAGACACTATTG
CAGACAGAGTTGGTCGGATTCGATGCCCTCGAGCGTGTTCCCCTTGGCTGACTCTTGGGGACCATAGGGTCATAA
ACGCTGGGAAAAGGCGGTAGTTTCCGGTCTGGAGAATCTACGCAGCCTCGTCCATGAAAACTTCCTCCCGGCCCT
CGAGCGTTGCGCTCTCATACTCAGCCGGCTTCGAGGGCTCGCCCAGTTTCACGACGACCGCGATGACATTGGCTT
CTCCGTTTCCCAGATCAGCCGCGTCTTGGACATCATCAGCTGTCTGCACCTCGCTGGCCACAAGATTCTCGTCCA
CGTCATGGACGAGCTGGAGCACTTTGCAGCCTTTTCAGTCTGGTTACGTTTCCAGATCGACGGCTTGACCGGCCC
AGCGAGCCAAGAACTCACGGAGAGAGAGGCCACGATGGACACGTCCAGAGTCCTTACGTACATCGAGACTTACCT
CACCTCGAGCCCGCTCGACATGTTCTTCGACGGCATCTCGACAAAGGACTTTGCGGCTGACTGGGATCATTGCGA
GGACGGACCGAGTCTGCTGCAGATGCTGGATACACAGCTTAAGAAGCGGGAAGATGGCCAGTCGAGCATGAGGGC
GCTTCCCCACGTTGACTTTCTCGTCAACTACATGACGACGTGGTGCGACAGGATCTTCAAGAGCGTCGCCGAACG
CATGGAGATGAGTGTACGATTCGGAATGCCCATCAAGCTTTCGGTTGGAGCCCCGATCAGCAAGATGGACGTTAG
AGTCGGCGAGGCTGCAAAGGTACGATGTTGGCTGGCCCTCTTCTTTGGTCGATTTCTTGACGCGTTTCGCGGCAC
AGGGAGGCGTCATCTACACCGCCGTCGCGTGCAGAAACAGCGAGAGCAAAGGTATGATACGAGGCTCATCGTCTG
GCAAGCAACAAGTGATGTTGACAACTGAGGGCGAGTGTACATCTTGCGCGCTGAGATGGACATCGCCGGCGGCAT
CAGCCGCAATCTGCCGGCGACGGGCTGCTGCATCGACCTAGCCAACCGCCAGCTTATCGACACCAGATTCCTCAA
CGACGAGACACTCATCGTGCTGTGCAAAGAAAACGGTACATGATGATCTGGCTGGGTCCAAGTGCTTCATCACTA
ATCTCGATCCAGACCTAACTTCGGCCGCGCTGTCCATACCGGTCCAGTCAAGTGAATTACCATATGCTCCGTTGG
GCGCCGGAGGGCTGGAAAGCGTCAACGTGATCCCAGCACATGGCTTTGTCAAATATGTGCTACCCGAACAGCAAG
CGGCGAGGATGGAGGTACACGACAAGAGCGAAGTCAAGGGGCAGATTCCCCCGAGGATATGTCTCCTCAGCAACG
ACGGGACCAGATGGCGAACGTACTCGATGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail