Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01869
Gene name
Locationscaffold_02:1957506..1959094
Strand-
Gene length (bp)1588
Transcript length (bp)1206
Coding sequence length (bp)1206
Protein length (aa) 402

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05653 Mg_trans_NIPA Magnesium transporter NIPA 2.4E-100 4 293

GO

GO Term Description Terminal node
GO:0015693 magnesium ion transport Yes
GO:0016021 integral component of membrane Yes
GO:0015095 magnesium ion transmembrane transporter activity Yes
GO:0006812 cation transport No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0006810 transport No
GO:0022857 transmembrane transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0031224 intrinsic component of membrane No
GO:0005215 transporter activity No
GO:0051179 localization No
GO:0008324 cation transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0015075 ion transmembrane transporter activity No
GO:0030001 metal ion transport No
GO:0006811 ion transport No
GO:0046873 metal ion transmembrane transporter activity No
GO:0008150 biological_process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Lysosome/Vacuole Signal peptide|Transmembrane domain 0.1063 0.1209 0.0249 0.4292 0.0664 0.0015 0.2217 0.6041 0.5279 0.0088

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 7 26 19
2 75 97 22
3 104 123 19
4 138 160 22
5 173 195 22
6 210 229 19
7 242 264 22
8 269 291 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4994
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6968
Ophiocordyceps australis map64 (Brazil) OphauB2|6929
Ophiocordyceps camponoti-floridani Ophcf2|01869 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6289
Ophiocordyceps kimflemingae Ophio5|8222
Ophiocordyceps subramaniannii Hirsu2|2335

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01869
MIEDKYIGLALAMSSALAIGTSFVITKKGLLDAEQRHGFEGDGFVYLRSPVWWAGIATLVIGEVCNFAAYAFAPA
ILVTPLGALSVLIGAVLGSYFLEEELGTLGKLGSAICLIGAVVIVLHAPPDEDIQTIDQILHYAIQPGFLLYAMA
VIAFAAVMIYKIAPVYGRKNALIYLSICSTVGSISVMSVKAFGIALKLTLAGNNQFSHPSTYVFMIMTTVCILIQ
MNYFNKALASFPTNIVNPLYYVTFTTATLCASFILFSGFNTTDAVNTLSLLCGFLVTFTGVYLLNLSRGDPNAHN
VPAGQMGHDSTPTDMVSSLQTRRSMQSRRSGDHVRHSVSSLHGDREGLIRAYDEEEAAGFGLTDLAEESEDGSHQ
SKSRVNGKKEINSGDIELEDRKSAER*
Coding >Ophcf2|01869
ATGATCGAAGACAAGTACATTGGCCTGGCGCTGGCCATGTCCTCGGCTCTCGCTATCGGCACCAGTTTCGTCATC
ACAAAAAAGGGACTGCTGGACGCCGAGCAACGACACGGCTTCGAGGGCGATGGTTTCGTCTACCTGAGGAGTCCA
GTGTGGTGGGCCGGCATCGCCACACTCGTAATTGGAGAAGTCTGCAATTTCGCCGCCTACGCGTTCGCGCCAGCC
ATCCTCGTCACGCCTCTCGGAGCACTCAGCGTCCTCATCGGTGCCGTCCTCGGCTCTTACTTTCTCGAGGAGGAA
CTGGGAACCTTGGGAAAGCTGGGCAGTGCCATCTGTCTCATCGGCGCTGTCGTCATCGTCCTCCACGCGCCACCC
GACGAAGACATTCAGACCATCGATCAGATCTTGCACTATGCCATCCAGCCAGGTTTCTTGCTCTACGCAATGGCC
GTCATCGCCTTCGCCGCTGTCATGATTTACAAGATCGCGCCCGTCTACGGAAGGAAGAACGCCCTCATCTACCTT
TCTATCTGCTCGACTGTCGGCTCCATCTCGGTCATGTCCGTCAAGGCCTTCGGCATCGCCCTCAAGCTCACTCTC
GCCGGCAACAACCAGTTCTCGCATCCGTCCACCTACGTCTTCATGATAATGACCACGGTCTGCATTCTCATTCAG
ATGAACTACTTCAACAAGGCGCTGGCGTCCTTTCCAACAAACATCGTCAACCCCTTGTACTACGTCACCTTCACT
ACGGCAACGCTGTGTGCGTCCTTCATCCTCTTCAGCGGCTTTAACACGACTGATGCCGTCAACACCCTGTCGTTG
CTCTGCGGTTTCCTCGTCACCTTTACCGGTGTCTACCTGCTCAACCTTTCGAGAGGCGATCCCAACGCGCACAAC
GTCCCCGCAGGGCAAATGGGCCACGACTCGACGCCGACTGATATGGTGTCGAGTCTGCAGACGCGTCGTAGCATG
CAATCTCGGCGCAGTGGCGACCACGTGCGGCACAGCGTGAGCAGCCTGCACGGCGATAGGGAAGGCCTGATACGG
GCATACGACGAAGAGGAGGCTGCAGGTTTCGGCCTCACCGACCTGGCCGAGGAGAGCGAGGATGGCTCGCACCAA
TCAAAAAGCCGCGTGAACGGCAAGAAAGAAATCAACTCGGGCGACATCGAGCTGGAGGATCGGAAATCTGCCGAG
AGGTAG
Transcript >Ophcf2|01869
ATGATCGAAGACAAGTACATTGGCCTGGCGCTGGCCATGTCCTCGGCTCTCGCTATCGGCACCAGTTTCGTCATC
ACAAAAAAGGGACTGCTGGACGCCGAGCAACGACACGGCTTCGAGGGCGATGGTTTCGTCTACCTGAGGAGTCCA
GTGTGGTGGGCCGGCATCGCCACACTCGTAATTGGAGAAGTCTGCAATTTCGCCGCCTACGCGTTCGCGCCAGCC
ATCCTCGTCACGCCTCTCGGAGCACTCAGCGTCCTCATCGGTGCCGTCCTCGGCTCTTACTTTCTCGAGGAGGAA
CTGGGAACCTTGGGAAAGCTGGGCAGTGCCATCTGTCTCATCGGCGCTGTCGTCATCGTCCTCCACGCGCCACCC
GACGAAGACATTCAGACCATCGATCAGATCTTGCACTATGCCATCCAGCCAGGTTTCTTGCTCTACGCAATGGCC
GTCATCGCCTTCGCCGCTGTCATGATTTACAAGATCGCGCCCGTCTACGGAAGGAAGAACGCCCTCATCTACCTT
TCTATCTGCTCGACTGTCGGCTCCATCTCGGTCATGTCCGTCAAGGCCTTCGGCATCGCCCTCAAGCTCACTCTC
GCCGGCAACAACCAGTTCTCGCATCCGTCCACCTACGTCTTCATGATAATGACCACGGTCTGCATTCTCATTCAG
ATGAACTACTTCAACAAGGCGCTGGCGTCCTTTCCAACAAACATCGTCAACCCCTTGTACTACGTCACCTTCACT
ACGGCAACGCTGTGTGCGTCCTTCATCCTCTTCAGCGGCTTTAACACGACTGATGCCGTCAACACCCTGTCGTTG
CTCTGCGGTTTCCTCGTCACCTTTACCGGTGTCTACCTGCTCAACCTTTCGAGAGGCGATCCCAACGCGCACAAC
GTCCCCGCAGGGCAAATGGGCCACGACTCGACGCCGACTGATATGGTGTCGAGTCTGCAGACGCGTCGTAGCATG
CAATCTCGGCGCAGTGGCGACCACGTGCGGCACAGCGTGAGCAGCCTGCACGGCGATAGGGAAGGCCTGATACGG
GCATACGACGAAGAGGAGGCTGCAGGTTTCGGCCTCACCGACCTGGCCGAGGAGAGCGAGGATGGCTCGCACCAA
TCAAAAAGCCGCGTGAACGGCAAGAAAGAAATCAACTCGGGCGACATCGAGCTGGAGGATCGGAAATCTGCCGAG
AGGTAG
Gene >Ophcf2|01869
ATGATCGAAGACAAGTACGTCTCCTCTTGTCGTCACGCGACCTTATGCGCCGCATTACATCAACGTCTGGGGCTG
ACAAGTCGCTTCGCAGGTACATTGGCCTGGCGCTGGCCATGTCCTCGGCTCTCGCTATCGGTGAGATGATTCCCG
CTCGCCATCACCTTGCGCGCACCTCGTTTGCTAACAGCCTCAGGCACCAGTTTCGTCATCACAAAAAAGGTTCGC
CGCCACCTCGTTTCTCGCATTCTCGTGCCTCTCCAGCCGTCATCGATGTTCTGACTGACTCGCGCCGTTAGGGAC
TGCTGGACGCCGAGCAACGACACGGCTTCGAGGGCGATGGTTTCGTCTACCTGAGGAGTCCAGTGTGGTGGGCCG
GCATCGCCACACGTGAGTCTCTTCTCCTGTGTTCCATGACAGAAACCGAGGCTGACCCCTTGTCCGTCTGTCCCC
AGTCGTAATTGGAGAAGTCTGCAATTTCGCCGCCTACGCGTTCGCGCCAGCCATCCTCGTCACGCCTCTCGGAGC
ACTCAGCGTCCTCATCGGTGCCGTCCTCGGCTCTTACTTTCTCGAGGAGGAACTGGGAACCTTGGGAAAGCTGGG
CAGTGCCATCTGTCTCATCGGCGCTGTCGTCATCGTCCTCCACGCGCCACCCGACGAAGACATTCAGACCATCGA
TCAGATCTTGCACTATGCCATCCAGCCAGGTATGAGCCATACCTCAACGTATGGACCGGACCCAGCCTGACCCGC
CGCCTAGGTTTCTTGCTCTACGCAATGGCCGTCATCGCCTTCGCCGCTGTCATGATTTACAAGATCGCGCCCGTC
TACGGAAGGAAGAACGCCCTCATCTACCTTTCTATCTGCTCGACTGTCGGCTCCATCTCGGTCATGTCCGTCAAG
GCCTTCGGCATCGCCCTCAAGCTCACTCTCGCCGGCAACAACCAGTTCTCGCATCCGTCCACCTACGTCTTCATG
ATAATGACCACGGTCTGCATTCTCATTCAGATGAACTACTTCAACAAGGCGCTGGCGTCCTTTCCAACAAACATG
TTAGTCGTTCCACCACCGTTCGTTGCGATACTAGGCACTGATCATCCCAAGCGTCAACCCCTTGTACTACGTCAC
CTTCACTACGGCAACGCTGTGTGCGTCCTTCATCCTCTTCAGCGGCTTTAACACGACTGATGCCGTCAACACCCT
GTCGTTGCTCTGCGGTTTCCTCGTCACCTTTACCGGTGTCTACCTGCTCAACCTTTCGAGAGGCGATCCCAACGC
GCACAACGTCCCCGCAGGGCAAATGGGCCACGACTCGACGCCGACTGATATGGTGTCGAGTCTGCAGACGCGTCG
TAGCATGCAATCTCGGCGCAGTGGCGACCACGTGCGGCACAGCGTGAGCAGCCTGCACGGCGATAGGGAAGGCCT
GATACGGGCATACGACGAAGAGGAGGCTGCAGGTTTCGGCCTCACCGACCTGGCCGAGGAGAGCGAGGATGGCTC
GCACCAATCAAAAAGCCGCGTGAACGGCAAGAAAGAAATCAACTCGGGCGACATCGAGCTGGAGGATCGGAAATC
TGCCGAGAGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail