Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01868
Gene name
Locationscaffold_02:1955551..1956424
Strand+
Gene length (bp)873
Transcript length (bp)783
Coding sequence length (bp)783
Protein length (aa) 261

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain 4.8E-24 109 191
PF07650 KH_2 KH domain 8.7E-12 23 97

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0006412 translation Yes
GO:0003735 structural constituent of ribosome Yes
GO:0043170 macromolecule metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0044237 cellular metabolic process No
GO:0009987 cellular process No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0005488 binding No
GO:1901576 organic substance biosynthetic process No
GO:0009058 biosynthetic process No
GO:0044260 cellular macromolecule metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0043604 amide biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0019538 protein metabolic process No
GO:0044238 primary metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0043043 peptide biosynthetic process No
GO:0003674 molecular_function No
GO:0006518 peptide metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0008150 biological_process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0005198 structural molecule activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5697 0.6487 0.0476 0.0931 0.4524 0.0049 0.1166 0.0526 0.0437 0.0016

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 820.12 392.44 1247.80
Alive In ants, during behavior modification 995.12 456.73 1533.50
Dead In ants, recently dead 1069.61 467.63 1671.58

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.459335 no
Alive Dead 0.779502 no
Dead Fungus 0.300275 no

Orthologs

Orthofinder run ID4
Orthogroup4993
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6967
Ophiocordyceps australis map64 (Brazil) OphauB2|6928
Ophiocordyceps camponoti-floridani Ophcf2|01868 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6288
Ophiocordyceps kimflemingae Ophio5|8223
Ophiocordyceps subramaniannii Hirsu2|2334

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01868
MAHSGTQLSKRRKFVADGVFYAELNEFFQRELAEEGYSGVEVRVTPTVTDIIIRATHTQEVLGEQGRRIRELTSL
IQKRFKFPENSVSLYAAKVQNRGLSAVAQCESLRYKLLNGLAVRRACYGVLRFIMESGAKGCEVVVSGKLRAARA
KSMKFTDGFMIHSGQPAKDFIDCATRHVLLRQGVLGIKVKIMRGSDPEGKAGPQKSLPDAVTIIEPKEEQPVVQP
MSQDYGAKAAQAQASQDARNAEQEGEEEEETAEQQ*
Coding >Ophcf2|01868
ATGGCGCACTCAGGAACCCAACTGTCCAAACGGAGAAAGTTCGTCGCCGATGGCGTCTTCTACGCCGAACTCAAT
GAGTTTTTCCAGCGTGAGCTGGCAGAGGAGGGTTACTCCGGCGTCGAGGTCCGCGTGACGCCTACCGTCACCGAT
ATCATCATCCGCGCCACCCACACGCAGGAGGTTCTCGGCGAGCAGGGCCGTCGCATCCGCGAGCTCACGTCGCTC
ATCCAAAAGCGCTTCAAGTTCCCCGAGAACTCCGTCTCCCTCTACGCCGCAAAGGTCCAAAATCGTGGCCTCTCC
GCCGTCGCCCAGTGCGAGTCCCTCCGCTACAAACTTCTCAATGGCCTCGCCGTCCGCCGCGCCTGCTATGGCGTC
CTTCGCTTCATCATGGAGAGCGGCGCAAAGGGTTGCGAGGTGGTCGTCTCCGGAAAGCTTCGCGCTGCCCGCGCC
AAGAGCATGAAGTTCACCGACGGCTTCATGATTCACTCGGGTCAACCCGCAAAGGACTTTATCGACTGCGCCACT
CGTCACGTCCTTCTCCGTCAGGGTGTTCTCGGCATCAAGGTCAAGATCATGCGCGGCTCCGACCCCGAAGGCAAG
GCCGGCCCTCAAAAGTCTCTGCCCGACGCCGTCACAATTATCGAGCCCAAGGAGGAGCAGCCCGTCGTGCAGCCT
ATGAGCCAAGACTACGGCGCTAAGGCCGCCCAAGCTCAGGCCAGCCAGGATGCGCGAAACGCCGAGCAGGAGGGT
GAGGAGGAAGAGGAGACCGCTGAGCAGCAATAG
Transcript >Ophcf2|01868
ATGGCGCACTCAGGAACCCAACTGTCCAAACGGAGAAAGTTCGTCGCCGATGGCGTCTTCTACGCCGAACTCAAT
GAGTTTTTCCAGCGTGAGCTGGCAGAGGAGGGTTACTCCGGCGTCGAGGTCCGCGTGACGCCTACCGTCACCGAT
ATCATCATCCGCGCCACCCACACGCAGGAGGTTCTCGGCGAGCAGGGCCGTCGCATCCGCGAGCTCACGTCGCTC
ATCCAAAAGCGCTTCAAGTTCCCCGAGAACTCCGTCTCCCTCTACGCCGCAAAGGTCCAAAATCGTGGCCTCTCC
GCCGTCGCCCAGTGCGAGTCCCTCCGCTACAAACTTCTCAATGGCCTCGCCGTCCGCCGCGCCTGCTATGGCGTC
CTTCGCTTCATCATGGAGAGCGGCGCAAAGGGTTGCGAGGTGGTCGTCTCCGGAAAGCTTCGCGCTGCCCGCGCC
AAGAGCATGAAGTTCACCGACGGCTTCATGATTCACTCGGGTCAACCCGCAAAGGACTTTATCGACTGCGCCACT
CGTCACGTCCTTCTCCGTCAGGGTGTTCTCGGCATCAAGGTCAAGATCATGCGCGGCTCCGACCCCGAAGGCAAG
GCCGGCCCTCAAAAGTCTCTGCCCGACGCCGTCACAATTATCGAGCCCAAGGAGGAGCAGCCCGTCGTGCAGCCT
ATGAGCCAAGACTACGGCGCTAAGGCCGCCCAAGCTCAGGCCAGCCAGGATGCGCGAAACGCCGAGCAGGAGGGT
GAGGAGGAAGAGGAGACCGCTGAGCAGCAATAG
Gene >Ophcf2|01868
ATGGCGCACTCAGGAACCCAACTGTGAGTTGCTGCGAATCCAAAGACTAGGATTGGATTCTCTCGTTAGACGGGG
ACCTCCCAAAGCTCACACGATCATTCCCCCTCTCGCAGGTCCAAACGGAGAAAGTTCGTCGCCGATGGCGTCTTC
TACGCCGAACTCAATGAGTTTTTCCAGCGTGAGCTGGCAGAGGAGGGTTACTCCGGCGTCGAGGTCCGCGTGACG
CCTACCGTCACCGATATCATCATCCGCGCCACCCACACGCAGGAGGTTCTCGGCGAGCAGGGCCGTCGCATCCGC
GAGCTCACGTCGCTCATCCAAAAGCGCTTCAAGTTCCCCGAGAACTCCGTCTCCCTCTACGCCGCAAAGGTCCAA
AATCGTGGCCTCTCCGCCGTCGCCCAGTGCGAGTCCCTCCGCTACAAACTTCTCAATGGCCTCGCCGTCCGCCGC
GCCTGCTATGGCGTCCTTCGCTTCATCATGGAGAGCGGCGCAAAGGGTTGCGAGGTGGTCGTCTCCGGAAAGCTT
CGCGCTGCCCGCGCCAAGAGCATGAAGTTCACCGACGGCTTCATGATTCACTCGGGTCAACCCGCAAAGGACTTT
ATCGACTGCGCCACTCGTCACGTCCTTCTCCGTCAGGGTGTTCTCGGCATCAAGGTCAAGATCATGCGCGGCTCC
GACCCCGAAGGCAAGGCCGGCCCTCAAAAGTCTCTGCCCGACGCCGTCACAATTATCGAGCCCAAGGAGGAGCAG
CCCGTCGTGCAGCCTATGAGCCAAGACTACGGCGCTAAGGCCGCCCAAGCTCAGGCCAGCCAGGATGCGCGAAAC
GCCGAGCAGGAGGGTGAGGAGGAAGAGGAGACCGCTGAGCAGCAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail