Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01867
Gene name
Locationscaffold_02:1952218..1954830
Strand-
Gene length (bp)2612
Transcript length (bp)2487
Coding sequence length (bp)2487
Protein length (aa) 829

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06602 Myotub-related Myotubularin-like phosphatase domain 1.7E-151 118 575

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.7033 0.3343 0.0917 0.1264 0.1066 0.0035 0.2869 0.3098 0.2713 0.0687

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4998
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|328
Ophiocordyceps australis map64 (Brazil) OphauB2|6927
Ophiocordyceps camponoti-floridani Ophcf2|01867 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6723
Ophiocordyceps kimflemingae Ophio5|8224
Ophiocordyceps subramaniannii Hirsu2|2351

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01867
MEARKVIDNVQGIYGGQSTNGLLRLTDFHLVFCAPVKQAESTESESSPRPRERWLTYPILCYCALRPTPPSSRLA
PSIRIRCRDFTFVTFNFADNDAARLAFDFIFARTCRLGTVERLFAFHHKPLASEKGLNGWDLYDPRAEFRRQGIS
EKLADKGWRITSINKDYVFCDTYPAVLVVPTKISDNVLKYAREFRSRNRIPVLSYIHPVNNCTITRSSQPLAGIT
RKSNVQDEKLVAASFSAWMPGAADEPTPPVSQPESAGLEPDLSETERYEDELISRSAAMYDEKTGEQLVYGRQQT
NMIVDARPTINAIVNQVQGMGSENMDKYPFATKSFLNIDNIHAMRNSLNKVIEALKDADISPLPPNRELLNQSGW
LRHIHNVLDGSAIIARRIGIKHSHVLIHCSDGWDRTSQLSALAQIMLDPYYRTLEGFMVLVEKDWLSFGHMFRLR
SGHLSHEDWFVVQKDALAGSKVHPGDGDALQNVLSGAKRFFNQNKDDAELSSISEAASSHVVDDEATMPKMVSPV
FHQFLDCTYQLLRQSPNRFEFNERFLRRLLYHLYSCQYGTFLYNSEKQRQDARVSERTSSVWDYFLCRKAEFTNP
DYDGVIDDRVRGRERILLPSLKDIRWWHQLFGRTDDEMNGALNAAATAANDRQTAASSLSQATPKSSESPEPESV
LAAVETAHEPLTPSASAKVLSAALRDGLASLDIGANEPEQPSPDYALFRSGSPPETGEAVDRYAHLRDPEPVWKS
VCCVSAGSGHCRESSDHAGCGWAFVHQSDAPRSSCASNTAQSLRGSLSDDEHPTISNLEEESLSVDGERLLTDGV
CRG*
Coding >Ophcf2|01867
ATGGAGGCCAGGAAGGTCATCGACAATGTTCAAGGCATCTACGGCGGCCAGAGCACCAACGGCCTTCTGCGCCTG
ACGGATTTTCACCTGGTATTCTGCGCACCCGTCAAGCAAGCCGAAAGCACCGAATCTGAATCTTCGCCACGGCCG
CGAGAGCGCTGGCTCACGTATCCCATATTGTGCTACTGCGCGCTGCGGCCCACGCCTCCCTCGTCTCGTCTGGCG
CCTTCGATCCGCATTCGGTGCAGGGACTTTACCTTTGTCACCTTCAACTTTGCCGACAACGATGCTGCCCGACTG
GCCTTTGATTTCATATTCGCAAGGACTTGCAGGCTCGGTACAGTTGAGAGGCTCTTCGCCTTTCACCACAAGCCC
CTGGCCAGCGAAAAGGGCCTGAATGGCTGGGATCTCTACGATCCCAGAGCAGAGTTCCGCCGACAGGGCATCAGC
GAGAAACTCGCCGACAAGGGCTGGAGAATCACCAGCATCAACAAGGATTATGTCTTTTGCGACACCTACCCTGCC
GTCTTGGTCGTCCCCACGAAAATATCGGATAATGTCCTCAAGTACGCAAGGGAGTTTCGGTCGCGGAACCGGATC
CCGGTTCTATCCTACATCCATCCTGTCAACAACTGCACCATTACTCGGAGCTCTCAGCCGCTTGCTGGCATCACG
AGAAAGTCAAACGTCCAGGACGAGAAGCTCGTTGCCGCCTCCTTCTCCGCCTGGATGCCCGGAGCGGCGGATGAG
CCGACTCCCCCAGTAAGCCAACCAGAGTCGGCCGGCTTGGAGCCAGACCTCTCTGAGACAGAGCGATATGAGGAT
GAGCTCATCTCGAGGTCGGCAGCCATGTACGACGAGAAGACGGGCGAGCAGCTCGTCTACGGACGCCAGCAGACC
AACATGATTGTCGACGCCCGGCCCACGATCAACGCCATCGTCAACCAGGTGCAGGGCATGGGCTCGGAAAATATG
GACAAGTATCCGTTCGCCACAAAGTCTTTTCTCAACATAGACAACATCCATGCTATGCGCAACTCGCTCAACAAG
GTGATCGAGGCGCTCAAAGACGCCGACATATCGCCTCTCCCCCCCAACCGGGAGCTGCTTAACCAGAGCGGCTGG
CTCCGTCACATACACAACGTTCTCGACGGCTCGGCAATCATAGCTCGCCGCATCGGCATCAAGCACTCGCACGTG
CTCATCCACTGCTCCGACGGCTGGGATCGGACGAGCCAGCTGAGCGCGCTGGCCCAGATCATGCTGGATCCGTAC
TACAGAACCCTGGAGGGTTTCATGGTCCTCGTCGAGAAAGACTGGCTGTCGTTTGGTCACATGTTTAGGCTGCGT
TCTGGCCACCTCAGCCACGAAGACTGGTTCGTTGTACAAAAGGATGCTCTCGCCGGCTCAAAGGTTCACCCGGGC
GACGGCGACGCGCTGCAGAACGTGCTGAGCGGCGCCAAGCGCTTCTTCAACCAGAACAAGGACGACGCCGAGCTG
TCATCCATTAGCGAGGCGGCTTCCAGTCACGTGGTCGACGACGAGGCCACGATGCCAAAGATGGTCAGTCCCGTC
TTCCATCAGTTTCTCGATTGCACGTACCAGCTGCTGCGCCAGAGCCCGAACCGGTTCGAGTTCAACGAGCGCTTC
TTGCGTCGTCTGCTGTATCACCTGTACTCTTGCCAGTACGGCACCTTTCTCTACAACTCGGAGAAGCAGCGGCAG
GACGCCAGGGTCAGCGAGAGGACTTCTTCCGTCTGGGATTACTTCCTCTGCCGCAAGGCCGAGTTCACGAATCCC
GACTACGATGGCGTCATCGACGACCGCGTCAGGGGCCGCGAACGAATTCTGCTGCCCAGCCTCAAGGACATCAGA
TGGTGGCATCAGCTCTTCGGCCGCACCGACGACGAGATGAACGGCGCCCTCAACGCGGCGGCCACGGCGGCCAAC
GACCGTCAGACAGCAGCATCGAGCCTCAGTCAGGCCACGCCCAAGTCGTCTGAGTCTCCCGAGCCAGAATCCGTA
CTGGCTGCCGTGGAGACGGCGCATGAGCCTCTGACGCCCAGCGCATCAGCCAAGGTCCTCTCGGCCGCCTTGCGT
GACGGGCTCGCAAGCCTCGACATTGGCGCCAACGAGCCCGAACAACCCTCTCCGGACTATGCCCTGTTCCGCAGC
GGCAGTCCCCCGGAGACAGGCGAGGCGGTAGATCGGTACGCGCACCTGCGCGATCCCGAGCCCGTATGGAAGAGC
GTCTGCTGCGTCTCGGCCGGCTCAGGCCATTGCCGCGAGTCGTCGGATCACGCCGGCTGCGGATGGGCCTTTGTT
CACCAGTCCGACGCACCCCGCAGCTCTTGCGCCTCGAACACGGCCCAGTCTCTGCGCGGGAGTCTCTCGGACGAC
GAGCATCCGACCATCAGCAACCTGGAGGAGGAATCGCTCAGTGTCGATGGCGAGCGTCTGCTGACGGATGGGGTG
TGCCGAGGCTGA
Transcript >Ophcf2|01867
ATGGAGGCCAGGAAGGTCATCGACAATGTTCAAGGCATCTACGGCGGCCAGAGCACCAACGGCCTTCTGCGCCTG
ACGGATTTTCACCTGGTATTCTGCGCACCCGTCAAGCAAGCCGAAAGCACCGAATCTGAATCTTCGCCACGGCCG
CGAGAGCGCTGGCTCACGTATCCCATATTGTGCTACTGCGCGCTGCGGCCCACGCCTCCCTCGTCTCGTCTGGCG
CCTTCGATCCGCATTCGGTGCAGGGACTTTACCTTTGTCACCTTCAACTTTGCCGACAACGATGCTGCCCGACTG
GCCTTTGATTTCATATTCGCAAGGACTTGCAGGCTCGGTACAGTTGAGAGGCTCTTCGCCTTTCACCACAAGCCC
CTGGCCAGCGAAAAGGGCCTGAATGGCTGGGATCTCTACGATCCCAGAGCAGAGTTCCGCCGACAGGGCATCAGC
GAGAAACTCGCCGACAAGGGCTGGAGAATCACCAGCATCAACAAGGATTATGTCTTTTGCGACACCTACCCTGCC
GTCTTGGTCGTCCCCACGAAAATATCGGATAATGTCCTCAAGTACGCAAGGGAGTTTCGGTCGCGGAACCGGATC
CCGGTTCTATCCTACATCCATCCTGTCAACAACTGCACCATTACTCGGAGCTCTCAGCCGCTTGCTGGCATCACG
AGAAAGTCAAACGTCCAGGACGAGAAGCTCGTTGCCGCCTCCTTCTCCGCCTGGATGCCCGGAGCGGCGGATGAG
CCGACTCCCCCAGTAAGCCAACCAGAGTCGGCCGGCTTGGAGCCAGACCTCTCTGAGACAGAGCGATATGAGGAT
GAGCTCATCTCGAGGTCGGCAGCCATGTACGACGAGAAGACGGGCGAGCAGCTCGTCTACGGACGCCAGCAGACC
AACATGATTGTCGACGCCCGGCCCACGATCAACGCCATCGTCAACCAGGTGCAGGGCATGGGCTCGGAAAATATG
GACAAGTATCCGTTCGCCACAAAGTCTTTTCTCAACATAGACAACATCCATGCTATGCGCAACTCGCTCAACAAG
GTGATCGAGGCGCTCAAAGACGCCGACATATCGCCTCTCCCCCCCAACCGGGAGCTGCTTAACCAGAGCGGCTGG
CTCCGTCACATACACAACGTTCTCGACGGCTCGGCAATCATAGCTCGCCGCATCGGCATCAAGCACTCGCACGTG
CTCATCCACTGCTCCGACGGCTGGGATCGGACGAGCCAGCTGAGCGCGCTGGCCCAGATCATGCTGGATCCGTAC
TACAGAACCCTGGAGGGTTTCATGGTCCTCGTCGAGAAAGACTGGCTGTCGTTTGGTCACATGTTTAGGCTGCGT
TCTGGCCACCTCAGCCACGAAGACTGGTTCGTTGTACAAAAGGATGCTCTCGCCGGCTCAAAGGTTCACCCGGGC
GACGGCGACGCGCTGCAGAACGTGCTGAGCGGCGCCAAGCGCTTCTTCAACCAGAACAAGGACGACGCCGAGCTG
TCATCCATTAGCGAGGCGGCTTCCAGTCACGTGGTCGACGACGAGGCCACGATGCCAAAGATGGTCAGTCCCGTC
TTCCATCAGTTTCTCGATTGCACGTACCAGCTGCTGCGCCAGAGCCCGAACCGGTTCGAGTTCAACGAGCGCTTC
TTGCGTCGTCTGCTGTATCACCTGTACTCTTGCCAGTACGGCACCTTTCTCTACAACTCGGAGAAGCAGCGGCAG
GACGCCAGGGTCAGCGAGAGGACTTCTTCCGTCTGGGATTACTTCCTCTGCCGCAAGGCCGAGTTCACGAATCCC
GACTACGATGGCGTCATCGACGACCGCGTCAGGGGCCGCGAACGAATTCTGCTGCCCAGCCTCAAGGACATCAGA
TGGTGGCATCAGCTCTTCGGCCGCACCGACGACGAGATGAACGGCGCCCTCAACGCGGCGGCCACGGCGGCCAAC
GACCGTCAGACAGCAGCATCGAGCCTCAGTCAGGCCACGCCCAAGTCGTCTGAGTCTCCCGAGCCAGAATCCGTA
CTGGCTGCCGTGGAGACGGCGCATGAGCCTCTGACGCCCAGCGCATCAGCCAAGGTCCTCTCGGCCGCCTTGCGT
GACGGGCTCGCAAGCCTCGACATTGGCGCCAACGAGCCCGAACAACCCTCTCCGGACTATGCCCTGTTCCGCAGC
GGCAGTCCCCCGGAGACAGGCGAGGCGGTAGATCGGTACGCGCACCTGCGCGATCCCGAGCCCGTATGGAAGAGC
GTCTGCTGCGTCTCGGCCGGCTCAGGCCATTGCCGCGAGTCGTCGGATCACGCCGGCTGCGGATGGGCCTTTGTT
CACCAGTCCGACGCACCCCGCAGCTCTTGCGCCTCGAACACGGCCCAGTCTCTGCGCGGGAGTCTCTCGGACGAC
GAGCATCCGACCATCAGCAACCTGGAGGAGGAATCGCTCAGTGTCGATGGCGAGCGTCTGCTGACGGATGGGGTG
TGCCGAGGCTGA
Gene >Ophcf2|01867
ATGGAGGCCAGGAAGGTAAAAAAAAAAACAGCTGTCTTGCTCCGTTCTTTTCTCGACCATGGTGGCCTGAAGCTC
TCTAGGTCATCGACAATGTTCAAGGCATCTACGGCGGCCAGAGCACCAACGGCCTTCTGCGCCTGACGGATTTTC
ACCTGGTATTCTGCGCACCCGTCAAGCAAGCCGAAAGCACCGAATCTGAATCTTCGCCACGGCCGCGAGAGCGCT
GGCTCACGTATCCCATATTGTGCTACTGCGCGCTGCGGCCCACGCCTCCCTCGTCTCGTCTGGCGCCTTCGATCC
GCATTCGGTGCAGGGACTTTACCTTTGTCACCTTCAACTTTGCCGACAACGATGCTGCCCGACTGGCCTTTGATT
TCATATTCGCAAGGACTTGCAGGCTCGGTACAGTTGAGAGGCTCTTCGCCTTTCACCACAAGCCCCTGGCCAGCG
AAAAGGGCCTGAATGGCTGGGATCTCTACGATCCCAGAGCAGAGTTCCGCCGACAGGGCATCAGCGAGAAACTCG
CCGACAAGGGCTGGAGAATCACCAGCATCAACAAGGATTATGTCTTTTGCGACACCTACCCTGCCGTCTTGGTCG
TCCCCACGAAAATATCGGATAATGTCCTCAAGTACGCAAGGGAGTTTCGGTCGCGGAACCGGATCCCGGTTCTAT
CCTACATCCATCCTGTCAACAACTGCACCATTACTCGGAGCTCTCAGCCGCTTGCTGGCATCACGAGAAAGTCAA
ACGTCCAGGACGAGAAGCTCGTTGCCGCCTCCTTCTCCGCCTGGATGCCCGGAGCGGCGGATGAGCCGACTCCCC
CAGTAAGCCAACCAGAGTCGGCCGGCTTGGAGCCAGACCTCTCTGAGACAGAGCGATATGAGGATGAGCTCATCT
CGAGGTCGGCAGCCATGTACGACGAGAAGACGGGCGAGCAGCTCGTCTACGGACGCCAGCAGACCAACATGATTG
TCGACGCCCGGCCCACGATCAACGCCATCGTCAACCAGGTGCAGGGCATGGGCTCGGAAAATATGGACAAGTATC
CGTTCGCCACAAAGTCTTTTCTCAACATAGACAACATCCATGCTATGCGCAACTCGCTCAACAAGGTGATCGAGG
CGCTCAAAGACGCCGACATATCGCCTCTCCCCCCCAACCGGGAGCTGCTTAACCAGAGCGGCTGGCTCCGTCACA
TACACAACGTTCTCGACGGCTCGGCAATCATAGCTCGCCGCATCGGCATCAAGCACTCGCACGTGCTCATCCACT
GCTCCGACGGCTGGGATCGGACGAGCCAGCTGAGCGCGCTGGCCCAGATCATGCTGGATCCGTACTACAGAACCC
TGGAGGGTTTCATGGTCCTCGTCGAGAAAGACTGGCTGTCGTTTGGTCACATGTTTAGGCTGCGTTCTGGCCACC
TCAGCCACGAAGACTGGTTCGTTGTACAAAAGGATGCTCTCGCCGGCTCAAAGGTTCACCCGGGCGACGGCGACG
CGCTGCAGAACGTGCTGAGCGGCGCCAAGCGCTTCTTCAACCAGAACAAGGACGACGCCGAGCTGTCATCCATTA
GCGAGGCGGCTTCCAGTCACGTGGTCGACGACGAGGCCACGATGCCAAAGATGGTCAGTCCCGTCTTCCATCAGT
TTCTCGATTGCACGTACCAGCTGCTGCGCCAGAGCCCGAACCGGTTCGAGTTCAACGAGCGCTTCTTGCGTCGTC
TGCTGTATCACCTGTACTCTTGCCAGTACGGCACCTTTCTCTACAACTCGGAGAAGCAGCGGCAGGACGCCAGGG
TCAGCGAGAGGACTTCTTCCGTCTGGGATTACTTCCTCTGCCGCAAGGCCGAGTTCACGAATCCCGACTACGATG
GCGTCATCGACGACCGCGTCAGGGGCCGCGAACGAATTCTGCTGCCCAGCCTCAAGGACATCAGATGGTGGCATC
AGCTCTTCGGCCGCACCGACGACGAGATGAACGGCGCCCTCAACGCGGCGGCCACGGCGGCCAACGACCGTCAGA
CAGCAGCATCGAGCCTCAGTCAGGCCACGCCCAAGTCGTCTGAGTCTCCCGAGCCAGAATCCGTACTGGCTGCCG
TGGAGACGGCGCATGAGCCTCTGACGCCCAGCGCATCAGCCAAGGTCCTCTCGGCCGCCTTGCGTGACGGGCTCG
CAAGCCTCGACATTGGCGCCAACGAGCCCGGTCAACAGACCACCCCTCGCAGTGACCAGGAGCTGCAAGAGATGA
CATAGGACGTCATAGAACAACCCTCTCCGGACTATGCCCTGTTCCGCAGCGGCAGTCCCCCGGAGACAGGCGAGG
CGGTAGATCGGTACGCGCACCTGCGCGATCCCGAGCCCGTATGGAAGAGCGTCTGCTGCGTCTCGGCCGGCTCAG
GCCATTGCCGCGAGTCGTCGGATCACGCCGGCTGCGGATGGGCCTTTGTTCACCAGTCCGACGCACCCCGCAGCT
CTTGCGCCTCGAACACGGCCCAGTCTCTGCGCGGGAGTCTCTCGGACGACGAGCATCCGACCATCAGCAACCTGG
AGGAGGAATCGCTCAGTGTCGATGGCGAGCGTCTGCTGACGGATGGGGTGTGCCGAGGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail