Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01863
Gene name
Locationscaffold_02:1944524..1945385
Strand+
Gene length (bp)861
Transcript length (bp)741
Coding sequence length (bp)741
Protein length (aa) 247

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01912 eIF-6 eIF-6 family 2.4E-79 4 203

GO

GO Term Description Terminal node
GO:0043022 ribosome binding Yes
GO:0042256 mature ribosome assembly Yes
GO:0071840 cellular component organization or biogenesis No
GO:0044877 protein-containing complex binding No
GO:0043021 ribonucleoprotein complex binding No
GO:0140694 non-membrane-bounded organelle assembly No
GO:0008150 biological_process No
GO:0042255 ribosome assembly No
GO:0006996 organelle organization No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0022607 cellular component assembly No
GO:0070925 organelle assembly No
GO:0016043 cellular component organization No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6967 0.1509 0.2406 0.2505 0.2141 0.0254 0.0648 0.4857 0.2952 0.006

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5030
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7167
Ophiocordyceps australis map64 (Brazil) OphauB2|6923
Ophiocordyceps camponoti-floridani Ophcf2|01863 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6719
Ophiocordyceps kimflemingae Ophio5|8228
Ophiocordyceps subramaniannii Hirsu2|2594

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01863
MAVRAQFENSNEVGVFSTLTNSYALVALGASENFYSVFEAELQDVVPTVRTTIAGTRIVGRLTAGNRKGLLVPTT
TTDQELQHLRNSLPDAVRIQRIEERLSALGNVIATNDHIALVHPDLERETEEIIADVLGVEVFRQTVADNVLVGS
YMSLSNQGGLVHPKTSIQDQDELSSLLQVPLVAGSVNRGSNVIGGGMVVNDWLAVTGLDTTATELSVIESVFRLG
EGLGPGKINTTMKDTMVESFY*
Coding >Ophcf2|01863
ATGGCGGTACGAGCACAATTCGAAAACTCCAACGAGGTCGGCGTCTTCTCGACTCTCACAAACTCCTACGCGCTC
GTCGCCCTCGGCGCAAGCGAAAACTTCTACAGCGTCTTCGAGGCTGAACTGCAGGACGTGGTGCCGACGGTGCGG
ACAACCATTGCCGGCACCCGTATCGTCGGACGGCTCACGGCGGGGAACCGCAAGGGCTTGCTTGTGCCGACGACG
ACGACAGATCAGGAGCTGCAGCACCTGCGTAACTCGCTGCCCGACGCGGTGCGCATCCAGCGGATTGAGGAACGT
CTCAGCGCGCTGGGGAACGTCATTGCCACTAACGATCATATCGCCCTCGTGCATCCCGATCTGGAGCGCGAGACG
GAGGAGATCATCGCCGACGTGTTGGGCGTAGAAGTCTTTCGCCAGACGGTAGCTGACAATGTCCTCGTCGGCAGC
TACATGAGCCTATCGAACCAGGGTGGACTCGTCCACCCCAAGACCAGCATCCAGGATCAGGACGAACTGTCGAGT
CTACTTCAGGTGCCTCTCGTCGCCGGCAGCGTCAACCGCGGGAGCAATGTGATTGGTGGCGGCATGGTGGTCAAC
GATTGGCTTGCCGTCACGGGGCTTGACACGACGGCTACTGAGCTGAGTGTCATTGAGAGCGTCTTCCGTCTGGGC
GAGGGACTTGGGCCTGGAAAGATCAATACGACGATGAAGGATACCATGGTGGAGAGCTTCTACTAG
Transcript >Ophcf2|01863
ATGGCGGTACGAGCACAATTCGAAAACTCCAACGAGGTCGGCGTCTTCTCGACTCTCACAAACTCCTACGCGCTC
GTCGCCCTCGGCGCAAGCGAAAACTTCTACAGCGTCTTCGAGGCTGAACTGCAGGACGTGGTGCCGACGGTGCGG
ACAACCATTGCCGGCACCCGTATCGTCGGACGGCTCACGGCGGGGAACCGCAAGGGCTTGCTTGTGCCGACGACG
ACGACAGATCAGGAGCTGCAGCACCTGCGTAACTCGCTGCCCGACGCGGTGCGCATCCAGCGGATTGAGGAACGT
CTCAGCGCGCTGGGGAACGTCATTGCCACTAACGATCATATCGCCCTCGTGCATCCCGATCTGGAGCGCGAGACG
GAGGAGATCATCGCCGACGTGTTGGGCGTAGAAGTCTTTCGCCAGACGGTAGCTGACAATGTCCTCGTCGGCAGC
TACATGAGCCTATCGAACCAGGGTGGACTCGTCCACCCCAAGACCAGCATCCAGGATCAGGACGAACTGTCGAGT
CTACTTCAGGTGCCTCTCGTCGCCGGCAGCGTCAACCGCGGGAGCAATGTGATTGGTGGCGGCATGGTGGTCAAC
GATTGGCTTGCCGTCACGGGGCTTGACACGACGGCTACTGAGCTGAGTGTCATTGAGAGCGTCTTCCGTCTGGGC
GAGGGACTTGGGCCTGGAAAGATCAATACGACGATGAAGGATACCATGGTGGAGAGCTTCTACTAG
Gene >Ophcf2|01863
ATGGCGGTACGAGCACAATTCGAAAACTCCAACGAGTAAGTTGAGCGGTTCCGTCAAGCCGCCGACAAGAGGTTG
CTGACACCCACTTACCAGGGTCGGCGTCTTCTCGACTCTCACAAACTCCTACGCGCTCGTCGCCCTCGGCGCAAG
CGAAAACTTCTACAGGTGCGCCCCGATGACGACCTACGAGTCAGGCGAGGACCAGGCTAAAACACAGCCGACCAC
AGCGTCTTCGAGGCTGAACTGCAGGACGTGGTGCCGACGGTGCGGACAACCATTGCCGGCACCCGTATCGTCGGA
CGGCTCACGGCGGGGAACCGCAAGGGCTTGCTTGTGCCGACGACGACGACAGATCAGGAGCTGCAGCACCTGCGT
AACTCGCTGCCCGACGCGGTGCGCATCCAGCGGATTGAGGAACGTCTCAGCGCGCTGGGGAACGTCATTGCCACT
AACGATCATATCGCCCTCGTGCATCCCGATCTGGAGCGCGAGACGGAGGAGATCATCGCCGACGTGTTGGGCGTA
GAAGTCTTTCGCCAGACGGTAGCTGACAATGTCCTCGTCGGCAGCTACATGAGCCTATCGAACCAGGGTGGACTC
GTCCACCCCAAGACCAGCATCCAGGATCAGGACGAACTGTCGAGTCTACTTCAGGTGCCTCTCGTCGCCGGCAGC
GTCAACCGCGGGAGCAATGTGATTGGTGGCGGCATGGTGGTCAACGATTGGCTTGCCGTCACGGGGCTTGACACG
ACGGCTACTGAGCTGAGTGTCATTGAGAGCGTCTTCCGTCTGGGCGAGGGACTTGGGCCTGGAAAGATCAATACG
ACGATGAAGGATACCATGGTGGAGAGCTTCTACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail