Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01858
Gene name
Locationscaffold_02:1934020..1935350
Strand+
Gene length (bp)1330
Transcript length (bp)1275
Coding sequence length (bp)1275
Protein length (aa) 425

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01873 eIF-5_eIF-2B Domain found in IF2B/IF5 5.4E-38 8 126
PF02020 W2 eIF4-gamma/eIF5/eIF2-epsilon 3.2E-22 336 421

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003743 translation initiation factor activity Yes
GO:0006413 translational initiation Yes
GO:0090079 translation regulator activity, nucleic acid binding No
GO:0008152 metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0045182 translation regulator activity No
GO:0008135 translation factor activity, RNA binding No
GO:0008150 biological_process No
GO:0003676 nucleic acid binding No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0044237 cellular metabolic process No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal|Nuclear export signal 0.598 0.7784 0.0261 0.0434 0.0617 0.0009 0.0396 0.1302 0.0842 0.0002

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5783
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5493
Ophiocordyceps australis map64 (Brazil) OphauB2|6919
Ophiocordyceps camponoti-floridani Ophcf2|01858 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6715
Ophiocordyceps kimflemingae Ophio5|8231
Ophiocordyceps subramaniannii Hirsu2|9674

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01858
MSLINVRRDVSDAFYRYKMERLQTKIEGKGNGIKTVVVNLPSVATSLARPPSYINKYFGFELGAMTNNDPKDDRW
IINGAHESGKLQDHLDGFINKFVLCKKCKNPETDVNINNDRILLDCKACGQRTDVDLRLKLSGYILKNQPGKKGK
MDKAERRAAKKAKQQNGHGNKENGNGSGEDASEHGSNENEENGDTGSDDEFQKMKAAAPDSADIEVKDDEWAVDM
SEEAVKARQASLPGEFKQKLSLNDDEDEDGEGGGNTVYDDLWGWIQRETEDKGSIDKVDSLEIYVKAKELGIEGK
HRTVLVLAQTLFNGTICAQIPKRASMLKQLVTSDRHEKALLGGTERLVGDISKDQPDMCQQIVKILQLYYHYDLI
SEEVVIKWGTKASKKYTDISTSRKIRKAAEPFLTWLKEADEEESSEDGE*
Coding >Ophcf2|01858
ATGTCTCTCATCAACGTTCGTCGCGATGTCAGCGATGCCTTCTATCGCTACAAGATGGAGCGTCTGCAGACCAAG
ATCGAGGGCAAAGGAAATGGCATCAAGACCGTCGTTGTCAACCTCCCCAGCGTCGCCACCTCTCTTGCACGCCCG
CCTTCGTACATCAACAAGTACTTCGGTTTTGAGCTCGGCGCCATGACCAACAACGATCCCAAGGACGATCGCTGG
ATCATCAACGGTGCTCATGAGTCGGGAAAACTTCAGGATCATCTCGATGGTTTCATCAACAAGTTTGTCCTCTGC
AAGAAGTGCAAGAACCCTGAGACCGACGTCAACATCAACAACGATCGCATCCTTCTCGATTGCAAGGCTTGTGGC
CAGCGCACCGATGTCGATCTCCGCCTCAAGCTCAGCGGCTACATCCTCAAGAATCAGCCGGGCAAGAAGGGCAAA
ATGGACAAGGCTGAGCGCCGTGCCGCCAAAAAGGCCAAGCAGCAGAATGGCCACGGAAACAAAGAAAACGGCAAC
GGTAGTGGCGAGGACGCCTCGGAGCATGGCTCCAACGAGAACGAGGAAAACGGGGATACGGGAAGCGACGATGAG
TTCCAGAAGATGAAGGCCGCCGCTCCTGACAGTGCAGACATTGAGGTCAAGGACGATGAATGGGCTGTTGACATG
AGCGAGGAGGCCGTCAAGGCCCGTCAGGCTTCGCTCCCCGGAGAGTTCAAGCAGAAGCTCAGCCTGAACGACGAC
GAGGATGAGGATGGCGAGGGCGGAGGTAACACCGTCTACGATGACCTTTGGGGATGGATCCAGCGGGAGACGGAG
GACAAGGGCAGCATCGACAAGGTTGACTCTCTCGAGATCTACGTCAAGGCCAAGGAGTTGGGCATCGAAGGCAAG
CATCGCACTGTCTTGGTTCTTGCCCAGACTCTGTTCAACGGCACCATCTGTGCTCAGATCCCCAAGCGGGCCAGC
ATGCTGAAGCAGCTTGTCACGTCCGATCGTCATGAGAAGGCTTTGCTTGGCGGCACCGAGCGTCTCGTCGGCGAT
ATATCCAAGGATCAGCCCGACATGTGTCAGCAGATTGTCAAGATTCTTCAGCTATACTATCACTACGACCTCATC
AGTGAGGAGGTGGTGATCAAATGGGGCACCAAGGCTAGCAAGAAGTACACGGACATCTCGACGTCGAGGAAGATT
CGCAAGGCTGCCGAGCCCTTCCTGACGTGGCTCAAGGAGGCTGACGAGGAGGAGTCGTCTGAGGACGGCGAATAG
Transcript >Ophcf2|01858
ATGTCTCTCATCAACGTTCGTCGCGATGTCAGCGATGCCTTCTATCGCTACAAGATGGAGCGTCTGCAGACCAAG
ATCGAGGGCAAAGGAAATGGCATCAAGACCGTCGTTGTCAACCTCCCCAGCGTCGCCACCTCTCTTGCACGCCCG
CCTTCGTACATCAACAAGTACTTCGGTTTTGAGCTCGGCGCCATGACCAACAACGATCCCAAGGACGATCGCTGG
ATCATCAACGGTGCTCATGAGTCGGGAAAACTTCAGGATCATCTCGATGGTTTCATCAACAAGTTTGTCCTCTGC
AAGAAGTGCAAGAACCCTGAGACCGACGTCAACATCAACAACGATCGCATCCTTCTCGATTGCAAGGCTTGTGGC
CAGCGCACCGATGTCGATCTCCGCCTCAAGCTCAGCGGCTACATCCTCAAGAATCAGCCGGGCAAGAAGGGCAAA
ATGGACAAGGCTGAGCGCCGTGCCGCCAAAAAGGCCAAGCAGCAGAATGGCCACGGAAACAAAGAAAACGGCAAC
GGTAGTGGCGAGGACGCCTCGGAGCATGGCTCCAACGAGAACGAGGAAAACGGGGATACGGGAAGCGACGATGAG
TTCCAGAAGATGAAGGCCGCCGCTCCTGACAGTGCAGACATTGAGGTCAAGGACGATGAATGGGCTGTTGACATG
AGCGAGGAGGCCGTCAAGGCCCGTCAGGCTTCGCTCCCCGGAGAGTTCAAGCAGAAGCTCAGCCTGAACGACGAC
GAGGATGAGGATGGCGAGGGCGGAGGTAACACCGTCTACGATGACCTTTGGGGATGGATCCAGCGGGAGACGGAG
GACAAGGGCAGCATCGACAAGGTTGACTCTCTCGAGATCTACGTCAAGGCCAAGGAGTTGGGCATCGAAGGCAAG
CATCGCACTGTCTTGGTTCTTGCCCAGACTCTGTTCAACGGCACCATCTGTGCTCAGATCCCCAAGCGGGCCAGC
ATGCTGAAGCAGCTTGTCACGTCCGATCGTCATGAGAAGGCTTTGCTTGGCGGCACCGAGCGTCTCGTCGGCGAT
ATATCCAAGGATCAGCCCGACATGTGTCAGCAGATTGTCAAGATTCTTCAGCTATACTATCACTACGACCTCATC
AGTGAGGAGGTGGTGATCAAATGGGGCACCAAGGCTAGCAAGAAGTACACGGACATCTCGACGTCGAGGAAGATT
CGCAAGGCTGCCGAGCCCTTCCTGACGTGGCTCAAGGAGGCTGACGAGGAGGAGTCGTCTGAGGACGGCGAATAG
Gene >Ophcf2|01858
ATGTCTCTCATCAACGTTCGTCGCGATGTCAGCGATGCCTTCTATCGCTACAAGATGGAGCGTCTGCAGACCAAG
ATCGAGGGCAAAGGAAATGGCATCAAGACCGTCGTTGTCAACCTCCCCAGCGTCGCCACCTCTCTTGCACGCCCG
CCTTCGTACATCAACAAGTACTTCGGTTTTGAGCTCGGCGCCATGACCAACAACGATCCCAAGGACGATCGCTGG
ATCATCAACGGTGCTCATGAGTCGGGAAAACTTCAGGATCATCTCGATGGTTTCATCAACAAGTTTGTCCTCTGC
AAGAAGTGCAAGAACCCTGAGACCGACGTCAACATCAACAACGATCGCATCCTTCTCGATTGCAAGGCTTGTGGC
CAGCGCACCGATGTCGATCTCCGCCTCAAGCTCAGCGGCTACATCCTCAAGAATCAGCCGGGCAAGAAGGGCAAA
ATGGACAAGGCTGAGCGCCGTGCCGCCAAAAAGGCCAAGCAGCAGAATGGCCACGGAAACAAAGAAAACGGCAAC
GGTAGTGGCGAGGACGCCTCGGAGCATGGCTCCAACGAGAACGAGGAAAACGGGGATACGGGAAGCGACGATGAG
TTCCAGAAGATGAAGGCCGCCGCTCCTGACAGTGCAGACATTGAGGTCAAGGACGATGAATGGGCTGTTGACATG
AGCGAGGAGGCCGTCAAGGCCCGTCAGGCTTCGCTCCCCGGAGAGTTCAAGCAGAAGCTCAGCCTGAACGACGAC
GAGGATGAGGATGGCGAGGGCGGAGGTAACACCGTCTACGATGACCTTTGGGGATGGATCCAGCGGGAGACGGAG
GACAAGGGCAGCATCGACAAGGTTGACTCTCTCGAGATCTACGTCAAGGCCAAGGAGTTGGGCATCGAAGGCAAG
CATCGCACTGTCTTGGTTCTTGCCCAGACTCTGTTCAACGGCACCATCTGTGCTCAGATCCCCAAGCGGGCCAGC
ATGCTGAAGCAGGTACGTTCTCTTGACGTCGAAAAGGGTATGTCAAGGCTTAGCTAACACCTTCAAGCTTGTCAC
GTCCGATCGTCATGAGAAGGCTTTGCTTGGCGGCACCGAGCGTCTCGTCGGCGATATATCCAAGGATCAGCCCGA
CATGTGTCAGCAGATTGTCAAGATTCTTCAGCTATACTATCACTACGACCTCATCAGTGAGGAGGTGGTGATCAA
ATGGGGCACCAAGGCTAGCAAGAAGTACACGGACATCTCGACGTCGAGGAAGATTCGCAAGGCTGCCGAGCCCTT
CCTGACGTGGCTCAAGGAGGCTGACGAGGAGGAGTCGTCTGAGGACGGCGAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail