Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01857
Gene name
Locationscaffold_02:1930521..1933532
Strand+
Gene length (bp)3011
Transcript length (bp)1716
Coding sequence length (bp)1716
Protein length (aa) 572

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06418 CTP_synth_N CTP synthase N-terminus 6.2E-119 2 268
PF00117 GATase Glutamine amidotransferase class-I 3.4E-54 313 542
PF07722 Peptidase_C26 Peptidase C26 2.3E-05 391 532

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0006221 pyrimidine nucleotide biosynthetic process Yes
GO:0003883 CTP synthase activity Yes
GO:0046483 heterocycle metabolic process No
GO:0044281 small molecule metabolic process No
GO:0003824 catalytic activity No
GO:0018130 heterocycle biosynthetic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0009058 biosynthetic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006753 nucleoside phosphate metabolic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0072528 pyrimidine-containing compound biosynthetic process No
GO:0009165 nucleotide biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0009987 cellular process No
GO:1901293 nucleoside phosphate biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0006220 pyrimidine nucleotide metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0016879 ligase activity, forming carbon-nitrogen bonds No
GO:0008150 biological_process No
GO:0072527 pyrimidine-containing compound metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0009117 nucleotide metabolic process No
GO:0090407 organophosphate biosynthetic process No
GO:0003674 molecular_function No
GO:0016874 ligase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0071704 organic substance metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.4875 0.4852 0.361 0.0767 0.4853 0.1741 0.3678 0.3615 0.3178 0.0822

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5266
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4311
Ophiocordyceps australis map64 (Brazil) OphauB2|5544
Ophiocordyceps camponoti-floridani Ophcf2|01857 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6712
Ophiocordyceps kimflemingae Ophio5|590
Ophiocordyceps subramaniannii Hirsu2|4558

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01857
MKYVVVSGGVVSGVGKGIIASSAGLLLKTIGLKVTAIKIDPYINVDAGTMNPKEHGECFVLKDGGESDLDLGNYE
RYLALDLTRDNNITTGKIYKDVIERERRGDYLGRTVQVVPHVTSAIIDHIERVSRIPVDGTGSEPDVCIIELGGT
LGDIESMPFVEALSQLRHKVGKNDSINIFVSYIPIVNGELKTKPTQHAVKCVRSAGLIPDLVACRCERPLDTVTM
AKIAQNCQIEAEQVVAVRDMPTIYQVPILLEQQGLLELLRHTLILDKVPLSPALVTKGAETWKKWKAIIPREHTE
KIDIALVGKYVELPDAYLSVVKSLEHSAMRCGRKLNLVWIDAEQLEDKAKEADPVGFYKAWHQVSTAAGILVPGG
FGQRGTEGMIKAAQWARERKTPYLGVCLGMQIAVIEYARHVCGRAHATSEEFNAQAEHRVVIFMPEGSKETMGGT
MRLGERATHFQPGSEHSKLRALYGEATVIEERHRHRYEVNPDHVDELEAAGLHFVGKDDSGRRMEILELDNHPWF
VGVQYHPDIVCGLSQPSVSTLLLPPSRLSLPQPQPQPRSRSARPAY*
Coding >Ophcf2|01857
ATGAAGTACGTCGTCGTCTCCGGAGGCGTCGTCAGCGGCGTCGGCAAGGGCATCATCGCCTCGTCAGCCGGTCTG
CTGCTCAAGACCATCGGCCTCAAGGTGACGGCCATTAAAATCGACCCGTACATCAATGTCGACGCCGGAACCATG
AATCCAAAGGAGCATGGCGAATGTTTTGTCCTCAAAGATGGCGGCGAGTCGGACCTGGATCTGGGAAACTACGAG
CGCTATCTGGCTTTGGACCTCACGCGTGATAACAACATCACTACGGGCAAGATCTATAAGGACGTCATCGAAAGA
GAGCGTCGTGGCGACTACCTTGGTCGCACCGTTCAAGTGGTTCCTCACGTCACCTCGGCTATCATCGATCACATC
GAGCGTGTGTCGAGAATCCCGGTTGACGGGACCGGCTCAGAACCCGACGTTTGCATCATCGAGTTGGGTGGCACT
CTAGGTGATATTGAGAGTATGCCCTTTGTCGAGGCTCTTTCGCAACTACGTCACAAGGTCGGCAAGAACGATTCG
ATCAACATCTTCGTCTCCTACATTCCCATTGTCAACGGGGAGCTGAAGACGAAGCCGACACAGCACGCCGTGAAG
TGTGTCCGTAGTGCGGGCCTGATTCCGGACCTTGTGGCTTGTCGCTGTGAGCGGCCACTGGATACGGTGACGATG
GCCAAAATCGCACAGAACTGTCAGATAGAGGCAGAACAGGTCGTGGCAGTTCGGGACATGCCCACCATCTACCAA
GTCCCGATCCTGCTGGAGCAGCAAGGCCTTCTAGAGCTTCTGCGCCACACTCTCATCTTGGACAAGGTGCCACTA
TCGCCGGCACTCGTGACCAAGGGCGCCGAGACATGGAAGAAGTGGAAGGCCATCATCCCGCGAGAGCACACGGAG
AAGATCGACATCGCCCTCGTCGGTAAATACGTCGAACTTCCTGACGCCTACCTGTCGGTCGTCAAGTCGCTCGAG
CACTCGGCTATGCGCTGCGGCCGCAAGCTTAACCTGGTATGGATCGACGCGGAGCAGCTAGAGGATAAGGCCAAG
GAGGCGGATCCCGTTGGCTTCTACAAGGCCTGGCACCAAGTCTCGACGGCTGCCGGCATTCTCGTCCCTGGCGGC
TTCGGCCAGCGAGGGACAGAGGGCATGATCAAGGCGGCTCAGTGGGCCCGAGAGCGCAAGACGCCCTACCTCGGC
GTCTGCCTTGGCATGCAGATCGCCGTCATAGAGTACGCGCGCCACGTGTGCGGCAGGGCCCACGCTACGTCGGAG
GAGTTCAACGCCCAGGCCGAGCACCGCGTCGTCATCTTCATGCCCGAAGGCTCCAAGGAGACCATGGGCGGCACC
ATGCGACTGGGCGAGCGCGCCACTCACTTCCAGCCGGGCAGCGAGCACAGCAAGCTGCGCGCCTTGTACGGCGAA
GCCACCGTGATCGAGGAGCGTCATCGTCACCGCTACGAGGTCAACCCGGACCATGTTGACGAACTCGAGGCGGCG
GGCCTGCACTTCGTCGGCAAAGACGACTCGGGCCGGCGCATGGAGATCTTGGAGCTCGACAACCACCCCTGGTTT
GTCGGCGTGCAGTACCATCCCGACATCGTCTGCGGACTCTCTCAGCCTTCTGTATCCACGCTTCTTCTTCCCCCA
TCTCGTCTGTCGCTGCCGCAGCCACAGCCGCAGCCGCGCTCGCGTTCCGCCCGCCCCGCATACTGA
Transcript >Ophcf2|01857
ATGAAGTACGTCGTCGTCTCCGGAGGCGTCGTCAGCGGCGTCGGCAAGGGCATCATCGCCTCGTCAGCCGGTCTG
CTGCTCAAGACCATCGGCCTCAAGGTGACGGCCATTAAAATCGACCCGTACATCAATGTCGACGCCGGAACCATG
AATCCAAAGGAGCATGGCGAATGTTTTGTCCTCAAAGATGGCGGCGAGTCGGACCTGGATCTGGGAAACTACGAG
CGCTATCTGGCTTTGGACCTCACGCGTGATAACAACATCACTACGGGCAAGATCTATAAGGACGTCATCGAAAGA
GAGCGTCGTGGCGACTACCTTGGTCGCACCGTTCAAGTGGTTCCTCACGTCACCTCGGCTATCATCGATCACATC
GAGCGTGTGTCGAGAATCCCGGTTGACGGGACCGGCTCAGAACCCGACGTTTGCATCATCGAGTTGGGTGGCACT
CTAGGTGATATTGAGAGTATGCCCTTTGTCGAGGCTCTTTCGCAACTACGTCACAAGGTCGGCAAGAACGATTCG
ATCAACATCTTCGTCTCCTACATTCCCATTGTCAACGGGGAGCTGAAGACGAAGCCGACACAGCACGCCGTGAAG
TGTGTCCGTAGTGCGGGCCTGATTCCGGACCTTGTGGCTTGTCGCTGTGAGCGGCCACTGGATACGGTGACGATG
GCCAAAATCGCACAGAACTGTCAGATAGAGGCAGAACAGGTCGTGGCAGTTCGGGACATGCCCACCATCTACCAA
GTCCCGATCCTGCTGGAGCAGCAAGGCCTTCTAGAGCTTCTGCGCCACACTCTCATCTTGGACAAGGTGCCACTA
TCGCCGGCACTCGTGACCAAGGGCGCCGAGACATGGAAGAAGTGGAAGGCCATCATCCCGCGAGAGCACACGGAG
AAGATCGACATCGCCCTCGTCGGTAAATACGTCGAACTTCCTGACGCCTACCTGTCGGTCGTCAAGTCGCTCGAG
CACTCGGCTATGCGCTGCGGCCGCAAGCTTAACCTGGTATGGATCGACGCGGAGCAGCTAGAGGATAAGGCCAAG
GAGGCGGATCCCGTTGGCTTCTACAAGGCCTGGCACCAAGTCTCGACGGCTGCCGGCATTCTCGTCCCTGGCGGC
TTCGGCCAGCGAGGGACAGAGGGCATGATCAAGGCGGCTCAGTGGGCCCGAGAGCGCAAGACGCCCTACCTCGGC
GTCTGCCTTGGCATGCAGATCGCCGTCATAGAGTACGCGCGCCACGTGTGCGGCAGGGCCCACGCTACGTCGGAG
GAGTTCAACGCCCAGGCCGAGCACCGCGTCGTCATCTTCATGCCCGAAGGCTCCAAGGAGACCATGGGCGGCACC
ATGCGACTGGGCGAGCGCGCCACTCACTTCCAGCCGGGCAGCGAGCACAGCAAGCTGCGCGCCTTGTACGGCGAA
GCCACCGTGATCGAGGAGCGTCATCGTCACCGCTACGAGGTCAACCCGGACCATGTTGACGAACTCGAGGCGGCG
GGCCTGCACTTCGTCGGCAAAGACGACTCGGGCCGGCGCATGGAGATCTTGGAGCTCGACAACCACCCCTGGTTT
GTCGGCGTGCAGTACCATCCCGACATCGTCTGCGGACTCTCTCAGCCTTCTGTATCCACGCTTCTTCTTCCCCCA
TCTCGTCTGTCGCTGCCGCAGCCACAGCCGCAGCCGCGCTCGCGTTCCGCCCGCCCCGCATACTGA
Gene >Ophcf2|01857
ATGAAGTACGTCGTCGTCTCCGGAGGCGTCGTCAGCGGCGTCGGCAAGGGCATCATCGCCTCGTCAGCCGGTCTG
CTGCTCAAGACCATCGGCCTCAAGGTGACGGCCATTAAAATCGACCCGTACATCAATGTCGACGCCGGAACCATG
AATCCAAAGGAGTGAGTGTCGCGCAATCTGGAAGCCGTCATGATTGCTGAGACTCGTCAAGGCATGGCGAATGTT
TTGTCCTCAAAGATGGCGGCGAGTCGGACCTGGATCTGGGAAACTACGAGCGGTAGGTCAGATTTGTCTTGGCTC
TCTCAGAGCCAGGCTGATCAGCTGAAATGGGCAGCTATCTGGCTTTGGACCTCACGCGTGATAACAACATCACTA
CGGGCAAGATCTATAAGGACGTCATCGAAAGAGAGCGTCGTGGCGACTACCTTGGTCGCACCGTTCAAGTGGTTC
CTCACGTCACCTCGGCTATCATCGATCACATCGAGCGTGTGTCGAGAATCCCGGTTGACGGGACCGGCTCAGAAC
CCGACGTTTGCATCAGTACGTAACAGCCCTTCCCGGCTCTCGCGTCGCTTGTCGCTAACGTTCAGTCTCTAGTCG
AGTTGGTAAGTCCGACGTCTACTCATTCGGCGGCTCTATCATCTGACGGTGTATTCAGGGTGGCACTCTAGGTGA
TATTGAGAGTATGCCCTTTGTCGAGGCTCTTTCGCAACTACGTCACAAGGTCGGCAAGAACGATTCGATCAACAT
CTTCGTCTCCTACATTCCCATTGTCAACGGGGAGCTGAAGACGAAGCCGACACAGCACGCCGTGAAGTGTGTCCG
TAGTGCGGGCCTGATTCCGGACCTTGTGAGTCGGCTCGCCTTCTTTCTTTTCGTCTTTTGGCTAAAGGTATTGTT
TGCAGGTGGCTTGTCGCTGTGAGCGGCCACTGGATACGGTGACGATGGCCAAAATCGCACAGAACTGTCAGATAG
AGGCAGAACAGGTCGTGGCAGTTCGGGACATGCCCACCATCTACCAAGTCCCGATCCTGCTGGAGCAGCAAGGCC
TTCTAGAGCTTCTGCGCCACACTCTCATCTTGGACAAGGTGCCACTATCGCCGGCACTCGTGACCAAGGGCGCCG
AGACATGGAAGAAGTGGAAGGCCATCATCCCGCGAGAGCACACGGAGAAGATCGACATCGCCCTCGTCGGTAAAT
ACGTCGAACTTCCTGACGCCTACCTGTCGGTCGTCAAGTCGCTCGAGCACTCGGCTATGCGCTGCGGCCGCAAGC
TTAACCTGGTATGGATCGACGCGGAGCAGCTAGAGGATAAGGCCAAGGAGGCGGATCCCGTTGGCTTCTACAAGG
CCTGGCACCAAGTCTCGACGGCTGCCGGCATTCTCGTCCCTGGCGGCTTCGGCCAGCGAGGGACAGAGGGCATGA
TCAAGGCGGCTCAGTGGGCCCGAGAGCGCAAGACGCCCTACCTCGGCGTCTGCCTTGGCATGCAGATCGCCGTCA
TAGAGTACGCGCGCCACGTGTGCGGCAGGGCCCACGCTACGTCGGAGGAGTTCAACGCCCAGGCCGAGCACCGCG
TCGTCATCTTCATGCCCGAAGGCTCCAAGGAGACCATGGGCGGCACCATGCGACTGGGCGAGCGCGCCACTCACT
TCCAGCCGGGCAGCGAGCACAGCAAGCTGCGCGCCTTGTACGGCGAAGCCACCGTGATCGAGGAGCGTCATCGTC
ACCGCTACGAGGTCAACCCGGACCATGTTGACGAACTCGAGGCGGCGGGCCTGCACTTCGTCGGCAAAGACGACT
CGGGCCGGCGCATGGAGATCTTGGAGCTCGACAACCACCCCTGGTTTGTCGGCGTGCAGTACCATCCCGAGTATC
TGAGCCGGGTACTAAACCCGTCCCGGCCGTATCTGGGCTTCGTCGCCGCTGCAGCCGGTTGTCTCGACAGGATTA
CGCAGGATATACTGGTCGAGGCCAAAAATATCAATGGCGCTAGCGACGGATCGCGATTCTGAGCGACATGCATGT
GGGTGTGGCGTCGATAGAAGGGGAAAACGATGGTTCAGGTTTGGAGTTTGGAGGCTGGAAAGGGAGTCGATAGTT
GGTGCTCTGGACGTTTCCTCTGAGTACATCGTAAGTATTCGTAGATAGTCACCAACAATCGTTGGACGGATGATT
CTATCCCGACCGGCAGGAAATGCGTTCGTACCCAACCGGACACTCTGGTCTCGGTCACAATAGGTAGGTTAAGGT
GAGGTAGGTAGAGGTCACGGTGCTGTGCCAGTGATCGATGGAAGCACACACGTAGCGACGGAAGCCAACACTGTA
CCGCACTTCCCAGGGCGACTTCCGTTGGCCGGGCTGAGACTACTGGATTCCAGCCGTCGGGCGGTCTTCCCAAGC
GTTCAACGATGCTGGGAATTGAGGACAGCAGATGCCGTTACACCGGAGCCTCTCGGCATGTACATAGGTAGGGAG
GGCAGTGAGTGGCGGATGAAAGCCAGCCGCGTCAGACCTCTCGCACCAGCGGGGAACCTCCAGCCGGCACCGGAC
ACTAGCAGCAGACGCCCTGATCCGCCGCGCCCTGGAGCTAGCGGCGGTGCACGGACGGAGGTACCTTTATCTTTC
TGACTAAAGCCCCACTCAAGGAGCCACTTAATCGCGGCTGCCGACGACTTGATTCGCACCCCCTCCCAAAAAATT
CTGCCGGAGACAGACCCAATTCTTTTCCCCTTCGCCCTTCGCCTCTTTCGAGTTTTCTTCCTCTCTCCCTCTCTC
TCTTCTCCATCCTTTCCTCCCTCCCACTCCAGACACCGAACGCAACCAGCATCGTCTGCGGACTCTCTCAGCCTT
CTGTATCCGTACGCGATCTCATCTCCCATCTCCCTGCTCTGCTCTTTCGCCGCTGACAACTGTTTCGCTCATCAC
AGACGCTTCTTCTTCCCCCATCTCGTCTGTCGCTGCCGCAGCCACAGCCGCAGCCGCGCTCGCGTTCCGCCCGCC
CCGCATACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail