Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01856
Gene name
Locationscaffold_02:1927819..1928833
Strand-
Gene length (bp)1014
Transcript length (bp)894
Coding sequence length (bp)894
Protein length (aa) 298

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01066 CDP-OH_P_transf CDP-alcohol phosphatidyltransferase 4.0E-15 40 156

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0016780 phosphotransferase activity, for other substituted phosphate groups Yes
GO:0008654 phospholipid biosynthetic process Yes
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0044255 cellular lipid metabolic process No
GO:0016740 transferase activity No
GO:0009058 biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0005575 cellular_component No
GO:0006629 lipid metabolic process No
GO:0003674 molecular_function No
GO:0090407 organophosphate biosynthetic process No
GO:0008610 lipid biosynthetic process No
GO:0006644 phospholipid metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0008150 biological_process No
GO:0006793 phosphorus metabolic process No
GO:0019637 organophosphate metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.5

Transmembrane Domains

Domain # Start End Length
1 36 58 22
2 108 130 22
3 171 193 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 77.63 43.01 112.24
Alive In ants, during behavior modification 99.85 56.58 143.12
Dead In ants, recently dead 118.13 67.55 168.71

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.206988 no
Alive Dead 0.337434 no
Dead Fungus 0.024305 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01856
MSGLSDDADAGDGSVSGNGSARALARAGFETDCENIFLFWPNVIGYFRIVLAIASLYYMPLHPRTCSVLYSISCL
LDALDGYAARLFDQSTRFGAVLDMVTDRCTTSCLLVFLSSAFPRWAILFQCLIALDFSSHYMHMYATLVVGGADS
SHKNIDKSQSRLLNLYYSNKIVLFVFCVLNELFFIALYLLSFSSPLLSPHLIKGVDDSVVQPGAQVNASLLRQMF
ADPFSAGALELARANKMDSNGPWILAGISFPVMAMKQFINVVQLVKASKSLAEVDVKARRARGVSAAKVKKG*
Coding >Ophcf2|01856
ATGTCTGGTCTCTCGGACGATGCGGATGCTGGTGATGGCTCCGTCAGCGGCAACGGCTCGGCTCGGGCTTTGGCT
CGGGCTGGGTTTGAGACTGATTGCGAGAACATCTTTCTGTTCTGGCCTAATGTCATCGGCTATTTCCGGATCGTG
CTGGCGATTGCGTCGCTTTACTACATGCCGCTTCACCCTCGGACCTGTTCGGTCCTCTACAGCATTTCGTGTCTG
CTAGACGCGCTCGATGGTTACGCGGCCAGACTGTTCGACCAGTCGACTCGTTTCGGTGCCGTCCTGGACATGGTG
ACGGACCGATGCACTACGTCATGCCTGCTCGTCTTCCTGTCGTCGGCTTTTCCGCGGTGGGCCATCCTATTTCAG
TGCCTCATCGCACTCGACTTTTCAAGCCACTATATGCACATGTACGCCACGCTCGTCGTTGGAGGCGCCGACTCG
AGCCACAAGAACATCGACAAGAGCCAGAGCCGACTGCTGAATCTGTACTACTCAAATAAGATTGTCCTCTTCGTC
TTCTGCGTTCTCAACGAGCTCTTCTTCATCGCCCTCTACCTCCTGTCCTTTTCGTCGCCCCTGCTATCGCCGCAC
CTGATCAAGGGCGTTGACGATTCGGTCGTGCAGCCCGGCGCACAGGTCAACGCGTCGCTGCTGAGACAGATGTTC
GCCGACCCCTTTAGTGCCGGCGCGCTGGAGCTCGCTCGCGCCAACAAGATGGATTCTAACGGACCATGGATCTTG
GCCGGCATCAGCTTCCCTGTCATGGCCATGAAGCAGTTCATTAACGTGGTGCAGCTCGTTAAGGCCAGCAAGTCG
CTTGCCGAAGTCGACGTCAAGGCTCGTCGCGCGAGGGGCGTCTCGGCCGCCAAGGTCAAGAAGGGCTGA
Transcript >Ophcf2|01856
ATGTCTGGTCTCTCGGACGATGCGGATGCTGGTGATGGCTCCGTCAGCGGCAACGGCTCGGCTCGGGCTTTGGCT
CGGGCTGGGTTTGAGACTGATTGCGAGAACATCTTTCTGTTCTGGCCTAATGTCATCGGCTATTTCCGGATCGTG
CTGGCGATTGCGTCGCTTTACTACATGCCGCTTCACCCTCGGACCTGTTCGGTCCTCTACAGCATTTCGTGTCTG
CTAGACGCGCTCGATGGTTACGCGGCCAGACTGTTCGACCAGTCGACTCGTTTCGGTGCCGTCCTGGACATGGTG
ACGGACCGATGCACTACGTCATGCCTGCTCGTCTTCCTGTCGTCGGCTTTTCCGCGGTGGGCCATCCTATTTCAG
TGCCTCATCGCACTCGACTTTTCAAGCCACTATATGCACATGTACGCCACGCTCGTCGTTGGAGGCGCCGACTCG
AGCCACAAGAACATCGACAAGAGCCAGAGCCGACTGCTGAATCTGTACTACTCAAATAAGATTGTCCTCTTCGTC
TTCTGCGTTCTCAACGAGCTCTTCTTCATCGCCCTCTACCTCCTGTCCTTTTCGTCGCCCCTGCTATCGCCGCAC
CTGATCAAGGGCGTTGACGATTCGGTCGTGCAGCCCGGCGCACAGGTCAACGCGTCGCTGCTGAGACAGATGTTC
GCCGACCCCTTTAGTGCCGGCGCGCTGGAGCTCGCTCGCGCCAACAAGATGGATTCTAACGGACCATGGATCTTG
GCCGGCATCAGCTTCCCTGTCATGGCCATGAAGCAGTTCATTAACGTGGTGCAGCTCGTTAAGGCCAGCAAGTCG
CTTGCCGAAGTCGACGTCAAGGCTCGTCGCGCGAGGGGCGTCTCGGCCGCCAAGGTCAAGAAGGGCTGA
Gene >Ophcf2|01856
ATGTCTGGTCTCTCGGACGATGCGGATGCTGGTGATGGCTCCGTCAGCGGCAACGGCTCGGCTCGGGCTTTGGCT
CGGGCTGGGTTTGAGACTGATTGCGAGAACATCTTTCTGTTCTGGCCTAATGTCATCGGTAAGTGTTCTCGTTGA
CAATCTCCCTGTGGTCGTTCGCGTGCTGATGATGGTGTTTTGGGTTCAGGCTATTTCCGGATCGTGCTGGCGATT
GCGTCGCTTTACTACATGCCGCTTCACCCTCGGACCTGTTCGGTCCTCTACAGCATTTCGTGTCTGCTAGACGCG
CTCGATGGTTACGCGGCCAGACTGTTCGACCAGTCGACTCGTTTCGGTGCCGTCCTGGACATGGTGACGGACCGA
TGCACTACGTCATGCCTGCTCGTCTTCCTGTCGTCGGCTTTTCCGCGGTGGGCCATCCTATTTCAGTGCCTCATC
GCACTCGACTTTTCAAGCCACTATATGCACATGTACGCCACGCTCGTCGTTGGAGGCGCCGACTCGAGCCACAAG
AACATCGACAAGAGCCAGAGCCGACTGCTGAATCTGTACTACTCAAATAAGGTACGTCGCCGTGTTCTCTTCCTC
CGTCGAATGAGCCAGCTGACGTCATTGCAGATTGTCCTCTTCGTCTTCTGCGTTCTCAACGAGCTCTTCTTCATC
GCCCTCTACCTCCTGTCCTTTTCGTCGCCCCTGCTATCGCCGCACCTGATCAAGGGCGTTGACGATTCGGTCGTG
CAGCCCGGCGCACAGGTCAACGCGTCGCTGCTGAGACAGATGTTCGCCGACCCCTTTAGTGCCGGCGCGCTGGAG
CTCGCTCGCGCCAACAAGATGGATTCTAACGGACCATGGATCTTGGCCGGCATCAGCTTCCCTGTCATGGCCATG
AAGCAGTTCATTAACGTGGTGCAGCTCGTTAAGGCCAGCAAGTCGCTTGCCGAAGTCGACGTCAAGGCTCGTCGC
GCGAGGGGCGTCTCGGCCGCCAAGGTCAAGAAGGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail