Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01853
Gene name
Locationscaffold_02:1917923..1920127
Strand+
Gene length (bp)2204
Transcript length (bp)2142
Coding sequence length (bp)2142
Protein length (aa) 714

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00505 HMG_box HMG (high mobility group) box 3.1E-22 92 160
PF09011 HMG_box_2 HMG-box domain 1.6E-06 94 159

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3569 0.8673 0.2006 0.0487 0.0774 0.0005 0.0303 0.0423 0.0092 0.003

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
HMG

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3079
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|638
Ophiocordyceps australis map64 (Brazil) OphauB2|5980
Ophiocordyceps camponoti-floridani Ophcf2|01853 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6706
Ophiocordyceps kimflemingae Ophio5|6289
Ophiocordyceps subramaniannii Hirsu2|5347

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01853
MTQVLGLGRQMEAALGGLQPRHHAGSGGLSPSPSGTGSFRKRAATLGDAVDAGRQQHPQQHPQQQHLAQQQHQPH
QDGSRELICLCAPEPKIPRPRNAFILYRQHHQAQVTADNPKLSNPDISKIIGDKWKKESEAIKQNWKSLAEEEKQ
RHQNQYPNYRYQPRRGNKSQAGGWPSTTSPTEEHGRCPKCHGRPMATPQTPSTPFASSPAAKLAMTPQRLDTTPM
SRRSSLDHSPTALQPFTSKLPPVRDLEPPESGSPDSKRRRADGAGGYHSVSRYGSASDLPLADGLPPNPILSYAR
TPNKLPELGSLARSQSGPMPPPPTALRPQSASAPWLVDKDLTSRRHSCFDESLRLPPLQSPLSPSPARSQSIVDA
RNVGLSSSALALSSPTRDQTVARSSPQTLEDMVMSISFKRKVSLLASICPPAPPLRKGGAGQGETTRGAFIAVEG
PDTTLRRRAGNAIEKGLIACGEVQLKVWHDQNRDEQVPETISPTTTATSSTAATMTAHTSPTSSSPPVDADSEAM
KQTSPPPVRFGDVFQPYFKTMASWQTRAKQIGRHITGTNDDVDSEEQHADGERVEAPAPADESAVSSTEAIPVAL
AKEGFSLTIADRYACAMPIPDSYGAAEHWKWMATLWRGTLCPDLIVYVTAGDDGNERRTVELSRSMGLIVVKVPA
GKGLDEATERRLAFEVMEWMREGSFREPLPRDWRSHML*
Coding >Ophcf2|01853
ATGACGCAGGTTCTTGGACTGGGTCGACAGATGGAGGCTGCTCTTGGGGGGTTGCAGCCGCGGCATCACGCTGGT
AGCGGAGGCCTTTCACCATCACCCTCTGGCACCGGTTCGTTTAGGAAGCGGGCGGCGACGCTGGGGGATGCTGTC
GATGCTGGCCGCCAGCAGCATCCTCAGCAACATCCTCAGCAGCAGCATCTTGCTCAGCAACAGCATCAGCCGCAC
CAGGACGGCTCACGGGAGCTCATCTGCTTGTGTGCCCCAGAGCCCAAGATTCCACGGCCGCGAAACGCCTTCATT
CTCTATCGTCAGCACCACCAAGCCCAAGTCACGGCCGACAACCCCAAGCTGTCTAACCCGGACATCTCCAAGATC
ATCGGTGACAAGTGGAAGAAGGAGAGCGAGGCGATCAAACAGAACTGGAAGAGCCTTGCCGAGGAAGAGAAGCAA
CGTCACCAGAACCAATACCCCAACTATCGCTACCAGCCGCGTCGCGGAAACAAGTCACAGGCTGGCGGCTGGCCT
TCCACCACGTCGCCCACCGAGGAGCATGGCCGCTGCCCCAAGTGCCACGGCCGGCCCATGGCCACGCCTCAGACG
CCGTCTACGCCCTTTGCGTCGTCGCCCGCTGCTAAGCTGGCCATGACGCCCCAGAGGCTGGACACTACGCCCATG
TCGCGCCGCTCAAGCCTGGACCACTCGCCTACGGCCTTGCAGCCCTTTACCTCTAAGCTGCCACCCGTCCGCGAT
CTCGAGCCGCCCGAGTCTGGGTCGCCCGACAGCAAGAGGCGTCGGGCTGACGGCGCCGGTGGCTACCATAGCGTC
TCTCGGTACGGTTCGGCCTCCGATCTCCCCCTCGCTGATGGTCTGCCGCCGAACCCGATCCTCTCCTACGCCCGC
ACGCCCAATAAGCTGCCGGAGCTGGGGAGCTTGGCCAGATCACAGAGCGGGCCTATGCCTCCGCCTCCGACGGCC
CTGCGCCCGCAGTCGGCCTCTGCACCTTGGCTTGTCGACAAGGACCTGACGAGCCGCCGTCACAGCTGCTTCGAT
GAGTCGCTCCGCCTCCCACCGCTGCAGTCGCCTCTATCGCCGTCTCCCGCGCGTTCGCAGTCCATCGTGGACGCT
CGCAATGTCGGCTTGTCTTCATCGGCACTGGCGCTGTCGTCGCCGACGCGGGACCAGACGGTCGCTCGCTCCAGC
CCCCAGACACTCGAGGACATGGTCATGTCCATCTCGTTCAAGCGCAAGGTCTCGTTGCTGGCGAGTATCTGTCCG
CCCGCCCCGCCCCTGCGCAAGGGGGGCGCCGGTCAGGGTGAGACCACCCGAGGCGCCTTCATCGCCGTCGAGGGT
CCCGACACGACGCTGCGCCGGCGCGCCGGCAACGCCATCGAGAAGGGGCTCATTGCCTGCGGCGAGGTGCAGCTC
AAGGTGTGGCATGATCAGAATAGGGATGAGCAAGTGCCGGAGACGATCAGCCCGACAACGACGGCTACTTCTTCT
ACAGCTGCGACGATGACGGCCCATACTTCTCCGACGTCATCCTCGCCGCCTGTAGATGCCGACTCGGAGGCGATG
AAGCAGACTAGCCCCCCGCCGGTCCGGTTCGGCGACGTGTTCCAACCCTACTTCAAGACCATGGCCTCGTGGCAG
ACGCGGGCCAAGCAGATCGGCCGACACATCACCGGGACCAACGACGACGTCGACAGCGAGGAGCAGCACGCGGAC
GGCGAGCGTGTGGAGGCTCCAGCGCCGGCGGACGAGTCGGCTGTGTCATCGACCGAGGCTATTCCCGTGGCTCTG
GCCAAGGAAGGCTTCAGCCTGACCATCGCGGACCGATACGCGTGCGCGATGCCCATACCGGACAGCTACGGCGCG
GCGGAGCACTGGAAGTGGATGGCGACGCTGTGGCGCGGCACGCTGTGCCCGGACCTTATCGTCTATGTCACGGCT
GGCGACGATGGCAACGAGCGTAGAACGGTCGAGCTGTCGCGCAGCATGGGACTTATCGTCGTCAAGGTGCCGGCC
GGCAAGGGCCTCGACGAGGCGACGGAGAGGAGACTGGCGTTCGAGGTCATGGAGTGGATGCGCGAGGGCTCGTTC
CGCGAGCCGTTGCCGAGGGATTGGCGATCGCATATGCTTTGA
Transcript >Ophcf2|01853
ATGACGCAGGTTCTTGGACTGGGTCGACAGATGGAGGCTGCTCTTGGGGGGTTGCAGCCGCGGCATCACGCTGGT
AGCGGAGGCCTTTCACCATCACCCTCTGGCACCGGTTCGTTTAGGAAGCGGGCGGCGACGCTGGGGGATGCTGTC
GATGCTGGCCGCCAGCAGCATCCTCAGCAACATCCTCAGCAGCAGCATCTTGCTCAGCAACAGCATCAGCCGCAC
CAGGACGGCTCACGGGAGCTCATCTGCTTGTGTGCCCCAGAGCCCAAGATTCCACGGCCGCGAAACGCCTTCATT
CTCTATCGTCAGCACCACCAAGCCCAAGTCACGGCCGACAACCCCAAGCTGTCTAACCCGGACATCTCCAAGATC
ATCGGTGACAAGTGGAAGAAGGAGAGCGAGGCGATCAAACAGAACTGGAAGAGCCTTGCCGAGGAAGAGAAGCAA
CGTCACCAGAACCAATACCCCAACTATCGCTACCAGCCGCGTCGCGGAAACAAGTCACAGGCTGGCGGCTGGCCT
TCCACCACGTCGCCCACCGAGGAGCATGGCCGCTGCCCCAAGTGCCACGGCCGGCCCATGGCCACGCCTCAGACG
CCGTCTACGCCCTTTGCGTCGTCGCCCGCTGCTAAGCTGGCCATGACGCCCCAGAGGCTGGACACTACGCCCATG
TCGCGCCGCTCAAGCCTGGACCACTCGCCTACGGCCTTGCAGCCCTTTACCTCTAAGCTGCCACCCGTCCGCGAT
CTCGAGCCGCCCGAGTCTGGGTCGCCCGACAGCAAGAGGCGTCGGGCTGACGGCGCCGGTGGCTACCATAGCGTC
TCTCGGTACGGTTCGGCCTCCGATCTCCCCCTCGCTGATGGTCTGCCGCCGAACCCGATCCTCTCCTACGCCCGC
ACGCCCAATAAGCTGCCGGAGCTGGGGAGCTTGGCCAGATCACAGAGCGGGCCTATGCCTCCGCCTCCGACGGCC
CTGCGCCCGCAGTCGGCCTCTGCACCTTGGCTTGTCGACAAGGACCTGACGAGCCGCCGTCACAGCTGCTTCGAT
GAGTCGCTCCGCCTCCCACCGCTGCAGTCGCCTCTATCGCCGTCTCCCGCGCGTTCGCAGTCCATCGTGGACGCT
CGCAATGTCGGCTTGTCTTCATCGGCACTGGCGCTGTCGTCGCCGACGCGGGACCAGACGGTCGCTCGCTCCAGC
CCCCAGACACTCGAGGACATGGTCATGTCCATCTCGTTCAAGCGCAAGGTCTCGTTGCTGGCGAGTATCTGTCCG
CCCGCCCCGCCCCTGCGCAAGGGGGGCGCCGGTCAGGGTGAGACCACCCGAGGCGCCTTCATCGCCGTCGAGGGT
CCCGACACGACGCTGCGCCGGCGCGCCGGCAACGCCATCGAGAAGGGGCTCATTGCCTGCGGCGAGGTGCAGCTC
AAGGTGTGGCATGATCAGAATAGGGATGAGCAAGTGCCGGAGACGATCAGCCCGACAACGACGGCTACTTCTTCT
ACAGCTGCGACGATGACGGCCCATACTTCTCCGACGTCATCCTCGCCGCCTGTAGATGCCGACTCGGAGGCGATG
AAGCAGACTAGCCCCCCGCCGGTCCGGTTCGGCGACGTGTTCCAACCCTACTTCAAGACCATGGCCTCGTGGCAG
ACGCGGGCCAAGCAGATCGGCCGACACATCACCGGGACCAACGACGACGTCGACAGCGAGGAGCAGCACGCGGAC
GGCGAGCGTGTGGAGGCTCCAGCGCCGGCGGACGAGTCGGCTGTGTCATCGACCGAGGCTATTCCCGTGGCTCTG
GCCAAGGAAGGCTTCAGCCTGACCATCGCGGACCGATACGCGTGCGCGATGCCCATACCGGACAGCTACGGCGCG
GCGGAGCACTGGAAGTGGATGGCGACGCTGTGGCGCGGCACGCTGTGCCCGGACCTTATCGTCTATGTCACGGCT
GGCGACGATGGCAACGAGCGTAGAACGGTCGAGCTGTCGCGCAGCATGGGACTTATCGTCGTCAAGGTGCCGGCC
GGCAAGGGCCTCGACGAGGCGACGGAGAGGAGACTGGCGTTCGAGGTCATGGAGTGGATGCGCGAGGGCTCGTTC
CGCGAGCCGTTGCCGAGGGATTGGCGATCGCATATGCTTTGA
Gene >Ophcf2|01853
ATGACGCAGGTTCTTGGACTGGGTCGACAGATGGAGGCTGCTCTTGGGGGGTTGCAGCCGCGGCATCACGCTGGT
AGCGGAGGCCTTTCACCATCACCCTCTGGCACCGGTTCGTTTAGGAAGCGGGCGGCGACGCTGGGGGATGCTGTC
GATGCTGGCCGCCAGCAGCATCCTCAGCAACATCCTCAGCAGCAGCATCTTGCTCAGCAACAGCATCAGCCGCAC
CAGGACGGCTCACGGGAGCTCATCTGCTTGTGTGCCCCAGAGCCCAAGATTCCACGGCCGCGAAACGGTGAGATA
TTCCTCGTCTGCTGTTGCTTCCATTCTCTCCGGTTTCTGACGGGCTTGCCGAAGCCTTCATTCTCTATCGTCAGC
ACCACCAAGCCCAAGTCACGGCCGACAACCCCAAGCTGTCTAACCCGGACATCTCCAAGATCATCGGTGACAAGT
GGAAGAAGGAGAGCGAGGCGATCAAACAGAACTGGAAGAGCCTTGCCGAGGAAGAGAAGCAACGTCACCAGAACC
AATACCCCAACTATCGCTACCAGCCGCGTCGCGGAAACAAGTCACAGGCTGGCGGCTGGCCTTCCACCACGTCGC
CCACCGAGGAGCATGGCCGCTGCCCCAAGTGCCACGGCCGGCCCATGGCCACGCCTCAGACGCCGTCTACGCCCT
TTGCGTCGTCGCCCGCTGCTAAGCTGGCCATGACGCCCCAGAGGCTGGACACTACGCCCATGTCGCGCCGCTCAA
GCCTGGACCACTCGCCTACGGCCTTGCAGCCCTTTACCTCTAAGCTGCCACCCGTCCGCGATCTCGAGCCGCCCG
AGTCTGGGTCGCCCGACAGCAAGAGGCGTCGGGCTGACGGCGCCGGTGGCTACCATAGCGTCTCTCGGTACGGTT
CGGCCTCCGATCTCCCCCTCGCTGATGGTCTGCCGCCGAACCCGATCCTCTCCTACGCCCGCACGCCCAATAAGC
TGCCGGAGCTGGGGAGCTTGGCCAGATCACAGAGCGGGCCTATGCCTCCGCCTCCGACGGCCCTGCGCCCGCAGT
CGGCCTCTGCACCTTGGCTTGTCGACAAGGACCTGACGAGCCGCCGTCACAGCTGCTTCGATGAGTCGCTCCGCC
TCCCACCGCTGCAGTCGCCTCTATCGCCGTCTCCCGCGCGTTCGCAGTCCATCGTGGACGCTCGCAATGTCGGCT
TGTCTTCATCGGCACTGGCGCTGTCGTCGCCGACGCGGGACCAGACGGTCGCTCGCTCCAGCCCCCAGACACTCG
AGGACATGGTCATGTCCATCTCGTTCAAGCGCAAGGTCTCGTTGCTGGCGAGTATCTGTCCGCCCGCCCCGCCCC
TGCGCAAGGGGGGCGCCGGTCAGGGTGAGACCACCCGAGGCGCCTTCATCGCCGTCGAGGGTCCCGACACGACGC
TGCGCCGGCGCGCCGGCAACGCCATCGAGAAGGGGCTCATTGCCTGCGGCGAGGTGCAGCTCAAGGTGTGGCATG
ATCAGAATAGGGATGAGCAAGTGCCGGAGACGATCAGCCCGACAACGACGGCTACTTCTTCTACAGCTGCGACGA
TGACGGCCCATACTTCTCCGACGTCATCCTCGCCGCCTGTAGATGCCGACTCGGAGGCGATGAAGCAGACTAGCC
CCCCGCCGGTCCGGTTCGGCGACGTGTTCCAACCCTACTTCAAGACCATGGCCTCGTGGCAGACGCGGGCCAAGC
AGATCGGCCGACACATCACCGGGACCAACGACGACGTCGACAGCGAGGAGCAGCACGCGGACGGCGAGCGTGTGG
AGGCTCCAGCGCCGGCGGACGAGTCGGCTGTGTCATCGACCGAGGCTATTCCCGTGGCTCTGGCCAAGGAAGGCT
TCAGCCTGACCATCGCGGACCGATACGCGTGCGCGATGCCCATACCGGACAGCTACGGCGCGGCGGAGCACTGGA
AGTGGATGGCGACGCTGTGGCGCGGCACGCTGTGCCCGGACCTTATCGTCTATGTCACGGCTGGCGACGATGGCA
ACGAGCGTAGAACGGTCGAGCTGTCGCGCAGCATGGGACTTATCGTCGTCAAGGTGCCGGCCGGCAAGGGCCTCG
ACGAGGCGACGGAGAGGAGACTGGCGTTCGAGGTCATGGAGTGGATGCGCGAGGGCTCGTTCCGCGAGCCGTTGC
CGAGGGATTGGCGATCGCATATGCTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail