Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01852
Gene name
Locationscaffold_02:1914315..1916136
Strand+
Gene length (bp)1821
Transcript length (bp)1377
Coding sequence length (bp)1377
Protein length (aa) 459

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06068 TIP49 TIP49 P-loop domain 2.7E-163 15 366
PF17856 TIP49_C TIP49 AAA-lid domain 2.8E-23 375 440
PF00004 AAA ATPase family associated with various cellular activities (AAA) 1.5E-06 67 119

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0016887 ATP hydrolysis activity Yes
GO:0097159 organic cyclic compound binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:1901265 nucleoside phosphate binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0003824 catalytic activity No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0016462 pyrophosphatase activity No
GO:0036094 small molecule binding No
GO:0043167 ion binding No
GO:0030554 adenyl nucleotide binding No
GO:0097367 carbohydrate derivative binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4497 0.621 0.0132 0.0596 0.1307 0.0086 0.1295 0.0249 0.0329 0.002

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1625
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5466
Ophiocordyceps australis map64 (Brazil) OphauB2|3235
Ophiocordyceps camponoti-floridani Ophcf2|01852 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6958
Ophiocordyceps kimflemingae Ophio5|5459
Ophiocordyceps subramaniannii Hirsu2|1296

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01852
MVQISEVKGNKRDNRTAAHSHIKGLGLKPDGYAEPQAAGFVGQTLAREACGGVVDLVRAHKMAGRGVLLAGGPGS
GKTALALAISQELGTKVPFCPIVGSEVFSTEVKKTEMLMENFRRAIGLKVRETKEVYEGEVTELTPEEAENPLGG
YGKTISTLLIGLKSAKGQKKLRLDPSIYEAIQKERVSVGDVIYIEANTGACKRVGRSDAYATEFDLEAEEYVPIP
KGEVHKKKEIVQDVTLHDLDVANARPQGGQDIMSMMSQLMKPKMTEITEKLRAEVNKVVSKYIDQGVAELVPGVL
FIDEAHMLDLECFTYLNRALESSIAPIVVLASNRGMCTIRGTDDSVAAFGIPADFLARLIIITTPPCQADEIKKI
VRIRATTEGVAISNAAVDKIAEHGVRVSLRYCLLLLTPASILAKANGRTQIDTEDVAECEDLFRDARRSASLLSS
EAGRGYMV*
Coding >Ophcf2|01852
ATGGTGCAGATCAGCGAAGTAAAGGGCAACAAGCGCGACAACCGAACCGCTGCCCACTCGCACATCAAGGGCCTC
GGCCTCAAGCCCGATGGTTACGCTGAGCCTCAGGCTGCGGGATTCGTGGGGCAGACGCTCGCTCGAGAGGCTTGC
GGCGGCGTCGTCGACCTTGTCCGCGCCCACAAGATGGCCGGACGGGGAGTGCTCCTTGCGGGCGGGCCCGGCTCG
GGAAAAACAGCGCTCGCGCTGGCCATTAGCCAGGAGCTAGGAACCAAGGTCCCATTCTGTCCCATCGTCGGCAGC
GAGGTCTTCTCGACCGAGGTCAAGAAGACGGAGATGCTGATGGAGAACTTTCGGCGGGCCATCGGGCTCAAGGTT
CGGGAGACGAAGGAGGTTTACGAGGGCGAGGTGACGGAGCTGACGCCAGAGGAGGCGGAGAACCCGCTGGGGGGT
TACGGCAAGACCATCAGCACGCTCCTCATCGGCCTCAAGAGCGCAAAGGGGCAGAAGAAGCTGCGGCTAGATCCC
AGCATTTACGAAGCCATCCAAAAGGAGCGCGTCTCTGTCGGCGACGTCATCTACATTGAAGCCAACACGGGGGCC
TGCAAGCGCGTGGGACGGTCGGATGCGTATGCGACAGAGTTTGACCTCGAGGCCGAGGAGTACGTGCCGATCCCA
AAGGGCGAGGTGCATAAGAAGAAGGAGATCGTGCAGGACGTTACGCTTCACGATCTCGACGTGGCCAACGCGCGG
CCGCAAGGCGGACAGGACATCATGAGCATGATGAGCCAGCTGATGAAGCCCAAGATGACGGAGATTACCGAGAAG
CTGCGAGCCGAGGTCAACAAGGTCGTCAGCAAATACATTGACCAGGGGGTGGCCGAGCTGGTACCGGGGGTACTG
TTCATTGATGAGGCGCACATGCTCGACCTTGAGTGCTTCACCTACCTCAACCGGGCGCTGGAATCGTCCATTGCA
CCGATTGTGGTGCTGGCGTCGAACCGCGGAATGTGCACAATAAGAGGCACCGACGACAGTGTCGCGGCGTTTGGC
ATTCCTGCCGACTTCCTGGCCCGGCTCATCATCATCACGACGCCGCCGTGTCAGGCTGACGAGATCAAGAAGATT
GTGAGGATAAGGGCGACAACCGAGGGGGTGGCCATCAGCAACGCCGCTGTCGACAAGATCGCCGAGCACGGCGTA
CGTGTCAGCCTGCGGTATTGTCTGCTGCTGCTGACTCCGGCGAGCATTCTTGCCAAGGCCAACGGGCGGACTCAG
ATCGACACGGAGGACGTGGCCGAGTGCGAGGACTTGTTCCGCGACGCCCGGCGGAGCGCCTCGCTGCTCAGCAGT
GAGGCTGGGCGGGGCTACATGGTGTAA
Transcript >Ophcf2|01852
ATGGTGCAGATCAGCGAAGTAAAGGGCAACAAGCGCGACAACCGAACCGCTGCCCACTCGCACATCAAGGGCCTC
GGCCTCAAGCCCGATGGTTACGCTGAGCCTCAGGCTGCGGGATTCGTGGGGCAGACGCTCGCTCGAGAGGCTTGC
GGCGGCGTCGTCGACCTTGTCCGCGCCCACAAGATGGCCGGACGGGGAGTGCTCCTTGCGGGCGGGCCCGGCTCG
GGAAAAACAGCGCTCGCGCTGGCCATTAGCCAGGAGCTAGGAACCAAGGTCCCATTCTGTCCCATCGTCGGCAGC
GAGGTCTTCTCGACCGAGGTCAAGAAGACGGAGATGCTGATGGAGAACTTTCGGCGGGCCATCGGGCTCAAGGTT
CGGGAGACGAAGGAGGTTTACGAGGGCGAGGTGACGGAGCTGACGCCAGAGGAGGCGGAGAACCCGCTGGGGGGT
TACGGCAAGACCATCAGCACGCTCCTCATCGGCCTCAAGAGCGCAAAGGGGCAGAAGAAGCTGCGGCTAGATCCC
AGCATTTACGAAGCCATCCAAAAGGAGCGCGTCTCTGTCGGCGACGTCATCTACATTGAAGCCAACACGGGGGCC
TGCAAGCGCGTGGGACGGTCGGATGCGTATGCGACAGAGTTTGACCTCGAGGCCGAGGAGTACGTGCCGATCCCA
AAGGGCGAGGTGCATAAGAAGAAGGAGATCGTGCAGGACGTTACGCTTCACGATCTCGACGTGGCCAACGCGCGG
CCGCAAGGCGGACAGGACATCATGAGCATGATGAGCCAGCTGATGAAGCCCAAGATGACGGAGATTACCGAGAAG
CTGCGAGCCGAGGTCAACAAGGTCGTCAGCAAATACATTGACCAGGGGGTGGCCGAGCTGGTACCGGGGGTACTG
TTCATTGATGAGGCGCACATGCTCGACCTTGAGTGCTTCACCTACCTCAACCGGGCGCTGGAATCGTCCATTGCA
CCGATTGTGGTGCTGGCGTCGAACCGCGGAATGTGCACAATAAGAGGCACCGACGACAGTGTCGCGGCGTTTGGC
ATTCCTGCCGACTTCCTGGCCCGGCTCATCATCATCACGACGCCGCCGTGTCAGGCTGACGAGATCAAGAAGATT
GTGAGGATAAGGGCGACAACCGAGGGGGTGGCCATCAGCAACGCCGCTGTCGACAAGATCGCCGAGCACGGCGTA
CGTGTCAGCCTGCGGTATTGTCTGCTGCTGCTGACTCCGGCGAGCATTCTTGCCAAGGCCAACGGGCGGACTCAG
ATCGACACGGAGGACGTGGCCGAGTGCGAGGACTTGTTCCGCGACGCCCGGCGGAGCGCCTCGCTGCTCAGCAGT
GAGGCTGGGCGGGGCTACATGGTGTAA
Gene >Ophcf2|01852
ATGGTGCAGATCAGCGAAGTAAAGGGCAACAAGCGCGACAACCGAACCGCTGCCCACTCGCACATCAAGGGCCTC
GGCCTCAAGCCCGATGGTTACGCTGAGCCTCAGGCTGCGGGATTCGTGGGGCAGACGCTCGCTCGAGAGGTACCG
ACTTGCGCTCTGAGGTCTCGATCAAGGGAAGAAAAAGCTGACCGTGGTTGCACTCGCTATAGGCTTGCGGCGGCG
TCGTCGACCTTGTCCGCGCCCACAAGATGGCCGGACGGGGAGTGCTCCTTGCGGGCGGGCCCGGCTCGGGAAAAA
CAGCGCTCGCGCTGGCCATTAGCCAGGAGCTAGGAACCAAGGTCCCATTCTGTCCCATCGTCGGCAGCGAGGTCT
TCTCGACCGAGGTCAAGAAGACGGAGATGCTGATGGAGAACTTTCGGCGGGCCATCGGGCTCAAGGTTCGGGAGA
CGAAGGAGGTTTACGAGGGCGAGGTGACGGAGCTGACGCCAGAGGAGGCGGAGAACCCGCTGGGGGGTTACGGCA
AGACCATCAGCACGCTCCTCATCGGCCTCAAGAGCGCAAAGGGGCAGAAGAAGCTGCGGCTAGATCCCAGCATTT
ACGAAGCCATCCAAAAGGAGCGCGTCTCTGTCGGCGACGTCATCTACATTGAAGCCAACACGGGGGCCTGCAAGC
GCGTGGGACGGTCGGATGCGTATGCGACAGAGTTTGACCTCGAGGCCGAGGAGTACGTGCCGATCCCAAAGGGCG
AGGTGCATAAGAAGAAGGAGATCGTGCAGGACGTTACGCTTCACGATCTCGACGTGGCCAACGCGCGGCCGCAAG
GCGGACAGGACATCATGAGCATGATGAGCCAGCTGATGAAGCCCAAGATGACGGAGATTACCGAGAAGCTGCGAG
CCGAGGTCAACAAGGTCGTCAGCAAATACATTGACCAGGGGGTGGCCGAGCTGGTACCGGGGGTACTGTTCATTG
ATGAGGTGCGTTAGGGGGACGACGTGTTGGAAGAGGGAGAGCCGGTACTGACAAGGACAACAAGGCGCACATGCT
CGACCTTGAGTGCTTCACCTACCTCAACCGGGCGCTGGAATCGTCCATTGCACCGATTGTGGTGCTGGCGTCGAA
CCGCGGAATGTGCACAATAAGAGGCACCGACGACAGTGTCGCGGCGTTTGGCATTCCTGCCGACTTCCTGGCCCG
GCTCATCATCATCACGACGCCGCCGTGTCAGGCTGACGAGATCAAGAAGATTGTGAGGATAAGGGCGACAACCGA
GGGGGTGGCCATCAGCAACGCCGCTGTCGACAAGATCGCCGAGCACGGCGTACGTGTCAGCCTGCGGTATTGTCT
GCTGCTGCTGACTCCGGCGAGGTGAGTTGATTACTTTGTCTGTCTCTTCCGTTGTGTCCGGTCTTCGGCTCTGCC
CAAGCCATCTAACCTCTCCCTTTTTTCAATGCTCCGTTTGCCCCGTCTTTCCGGTGCCCCCCCCCCTTTTCTCTC
CTCGTCATATCTTGTTTGAAGGTTGAATCTCGTTCATTCCTCGGGTCAAGATGTATAGTTTGTCGTCCCCTTGTC
GAACGCGTTCGATTCGCCCGTCTCCCGTGTCTTGGAATTTCTTTTTCCCCCCTCCCTTTGTCACTTTTTCTCGCG
ACGCGGGACAGAGAGGCCTGGGGGCTAACGGGCGGCAGCATTCTTGCCAAGGCCAACGGGCGGACTCAGATCGAC
ACGGAGGACGTGGCCGAGTGCGAGGACTTGTTCCGCGACGCCCGGCGGAGCGCCTCGCTGCTCAGCAGTGAGGCT
GGGCGGGGCTACATGGTGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail