Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01848
Gene name
Locationscaffold_02:1896533..1897370
Strand+
Gene length (bp)837
Transcript length (bp)786
Coding sequence length (bp)786
Protein length (aa) 262

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01694 Rhomboid Rhomboid family 6.9E-06 44 192
PF08551 DUF1751 Eukaryotic integral membrane protein (DUF1751) 2.0E-04 46 107

GO

GO Term Description Terminal node
GO:0004252 serine-type endopeptidase activity Yes
GO:0006890 retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum Yes
GO:0016021 integral component of membrane Yes
GO:0048193 Golgi vesicle transport No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0008236 serine-type peptidase activity No
GO:0006810 transport No
GO:0140096 catalytic activity, acting on a protein No
GO:0031224 intrinsic component of membrane No
GO:0017171 serine hydrolase activity No
GO:0003824 catalytic activity No
GO:0051179 localization No
GO:0005575 cellular_component No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0004175 endopeptidase activity No
GO:0016192 vesicle-mediated transport No
GO:0008233 peptidase activity No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22
2 50 72 22
3 84 106 22
4 164 186 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01848
MTFTNAPVTQLAVLGLVSGSVLTSLSDVKHYFYILIDTHLWRYRQLWRLLAYQLCYVNSAEVLFAAMSVYNLRPV
ERMWGSRKYASFLVVSYLLAALLCPLVMVVLRPVSVDLFNYVPPGPTPVIFAVLAQFYAMVPHTYKFRVATSHDA
SSGLTLSDKSYQYLVAFHLSLLQWPGSIVGAIVGWLIGHAWRGGVLPASLVTWRLPGWMVGTGTQGGGSAEFEGL
RRRLEGEERAVSTAIQGQPGGSQVDRRRPRGGRSGG*
Coding >Ophcf2|01848
ATGACCTTCACAAACGCTCCCGTGACCCAGCTAGCGGTCCTGGGCCTCGTGTCCGGCTCCGTCTTGACCAGCTTG
TCCGACGTAAAGCATTACTTCTACATCCTCATCGACACCCACCTCTGGCGCTATCGCCAGCTTTGGCGGCTTCTG
GCATACCAGCTCTGCTATGTCAACTCGGCTGAGGTGCTGTTCGCCGCCATGTCTGTCTACAACCTCCGGCCCGTC
GAACGCATGTGGGGTTCCAGGAAATACGCGTCGTTCCTCGTCGTCTCGTACCTATTGGCGGCCTTGCTGTGCCCT
CTGGTCATGGTGGTGCTGCGGCCGGTCTCGGTCGACCTGTTCAACTACGTGCCACCGGGCCCGACGCCCGTCATC
TTCGCCGTGCTCGCCCAGTTCTATGCCATGGTTCCACACACGTACAAGTTTCGTGTGGCGACGTCGCACGACGCG
TCGTCTGGGCTCACACTGTCAGACAAGTCTTATCAATACCTCGTCGCCTTCCATCTCTCCCTCCTGCAGTGGCCA
GGCTCCATCGTCGGCGCCATCGTCGGCTGGCTCATCGGTCACGCCTGGCGTGGCGGCGTGCTGCCCGCGTCACTC
GTGACGTGGCGGCTACCGGGCTGGATGGTGGGAACAGGCACGCAAGGGGGTGGCAGCGCCGAGTTTGAGGGTCTT
CGTCGCCGTCTCGAAGGCGAGGAGCGTGCCGTGTCCACGGCGATTCAGGGCCAGCCGGGCGGAAGTCAGGTGGAC
AGGAGGCGGCCAAGAGGCGGACGATCAGGCGGATGA
Transcript >Ophcf2|01848
ATGACCTTCACAAACGCTCCCGTGACCCAGCTAGCGGTCCTGGGCCTCGTGTCCGGCTCCGTCTTGACCAGCTTG
TCCGACGTAAAGCATTACTTCTACATCCTCATCGACACCCACCTCTGGCGCTATCGCCAGCTTTGGCGGCTTCTG
GCATACCAGCTCTGCTATGTCAACTCGGCTGAGGTGCTGTTCGCCGCCATGTCTGTCTACAACCTCCGGCCCGTC
GAACGCATGTGGGGTTCCAGGAAATACGCGTCGTTCCTCGTCGTCTCGTACCTATTGGCGGCCTTGCTGTGCCCT
CTGGTCATGGTGGTGCTGCGGCCGGTCTCGGTCGACCTGTTCAACTACGTGCCACCGGGCCCGACGCCCGTCATC
TTCGCCGTGCTCGCCCAGTTCTATGCCATGGTTCCACACACGTACAAGTTTCGTGTGGCGACGTCGCACGACGCG
TCGTCTGGGCTCACACTGTCAGACAAGTCTTATCAATACCTCGTCGCCTTCCATCTCTCCCTCCTGCAGTGGCCA
GGCTCCATCGTCGGCGCCATCGTCGGCTGGCTCATCGGTCACGCCTGGCGTGGCGGCGTGCTGCCCGCGTCACTC
GTGACGTGGCGGCTACCGGGCTGGATGGTGGGAACAGGCACGCAAGGGGGTGGCAGCGCCGAGTTTGAGGGTCTT
CGTCGCCGTCTCGAAGGCGAGGAGCGTGCCGTGTCCACGGCGATTCAGGGCCAGCCGGGCGGAAGTCAGGTGGAC
AGGAGGCGGCCAAGAGGCGGACGATCAGGCGGATGA
Gene >Ophcf2|01848
ATGACCTTCACAAACGCTCCCGTGACCCAGCTAGCGGTCCTGGGCCTCGTGTCCGGCTCCGTCTTGACCAGCTTG
TCCGACGTAAAGCATTACTTCTACATCCTCATCGACACCCACCTCTGGCGCTATCGCCAGCTTTGGCGGCTTCTG
GCATACCAGCTCTGCTATGTCAACTCGGCTGAGGTGCTGTTCGCCGCCATGTCTGTCTACAACCTCCGGCCCGTC
GAACGCATGTGGGGTTCCAGGAAATACGCGGTGAGTCGGCATGAGCATGCGACGCGCGCCGCCAGAATTGACCGT
CTGTAGTCGTTCCTCGTCGTCTCGTACCTATTGGCGGCCTTGCTGTGCCCTCTGGTCATGGTGGTGCTGCGGCCG
GTCTCGGTCGACCTGTTCAACTACGTGCCACCGGGCCCGACGCCCGTCATCTTCGCCGTGCTCGCCCAGTTCTAT
GCCATGGTTCCACACACGTACAAGTTTCGTGTGGCGACGTCGCACGACGCGTCGTCTGGGCTCACACTGTCAGAC
AAGTCTTATCAATACCTCGTCGCCTTCCATCTCTCCCTCCTGCAGTGGCCAGGCTCCATCGTCGGCGCCATCGTC
GGCTGGCTCATCGGTCACGCCTGGCGTGGCGGCGTGCTGCCCGCGTCACTCGTGACGTGGCGGCTACCGGGCTGG
ATGGTGGGAACAGGCACGCAAGGGGGTGGCAGCGCCGAGTTTGAGGGTCTTCGTCGCCGTCTCGAAGGCGAGGAG
CGTGCCGTGTCCACGGCGATTCAGGGCCAGCCGGGCGGAAGTCAGGTGGACAGGAGGCGGCCAAGAGGCGGACGA
TCAGGCGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail