Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01846
Gene name
Locationscaffold_02:1891712..1893591
Strand+
Gene length (bp)1879
Transcript length (bp)1740
Coding sequence length (bp)1740
Protein length (aa) 580

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00481 PP2C Protein phosphatase 2C 2.8E-41 188 451

GO

GO Term Description Terminal node
GO:0004722 protein serine/threonine phosphatase activity Yes
GO:0042578 phosphoric ester hydrolase activity No
GO:0003824 catalytic activity No
GO:0016791 phosphatase activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003674 molecular_function No
GO:0140096 catalytic activity, acting on a protein No
GO:0016787 hydrolase activity No
GO:0004721 phosphoprotein phosphatase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.5

Transmembrane Domains

Domain # Start End Length
1 50 72 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01846
MHRAALGALRTTSKYFGAARHVARARLTTHRLRLPVPPDAAPLPLRSSMYFRRLPALLISGIVIGYGAWYSLNDT
DGRFGSFTSSTQAFTSQQTTGRSVLVIGDDELTQATVIGDKPISKATTEDGQKVVDMLTPEQATRKLRREEKSFS
VNRGQGVTRYDLVQLASNDPIEDDHAEQIIQFPARKGEQDASRDWMFWGVYDGHSGWTTSATLRRSLISYVAREL
NNTYMAAKNDSPSAEAVDLAIKTGFNRLDHDIVHKSVEKVFKSNSKPVAAGLLQPALSGSCALLSFYDSKTKLLR
VACTGDSRAVLGRRSESGMWTASALSEDQTGSTPSEASRMRREHPGEEYVVRNGRVLGGLEPTRAFGDAVYKWSR
EVAGKLRESFFGRSPSPLLKTPPYVTAEPVVTTTRIDPDKGDFLVLATDGLWEMLTNEEVVGLVGKWIEAQSAPE
EGTSQFRKAWANVFGFPAKPLPVEQQQSRDGAQGQKTPIRLLQWGVSPDAKDRFTVRDNNVATHLVRNALGGNDN
ELLRALLTLPAPFSRRYRDDLTVQVIFFGNGEKTGDVTLNLDATYEPDPPKAEL*
Coding >Ophcf2|01846
ATGCACCGCGCTGCCCTTGGGGCCCTCCGAACGACGTCGAAGTACTTCGGCGCCGCAAGGCACGTGGCACGCGCA
CGCCTGACGACGCACCGCCTTCGGCTGCCCGTGCCCCCTGACGCTGCCCCGTTGCCTCTCCGGTCTTCCATGTAT
TTCCGCAGGCTGCCAGCCCTCCTCATCTCGGGCATCGTCATCGGCTACGGCGCCTGGTACTCGCTCAACGACACC
GACGGCCGCTTCGGAAGCTTCACGTCCTCAACGCAGGCCTTTACCTCTCAGCAAACGACGGGACGCAGTGTGCTC
GTCATTGGCGATGACGAGCTGACGCAGGCCACCGTCATTGGCGACAAGCCCATCTCGAAGGCCACGACAGAGGAC
GGACAGAAGGTTGTCGATATGTTGACGCCCGAGCAGGCTACGCGCAAGCTGCGTCGGGAGGAGAAGTCTTTCTCC
GTTAACCGGGGCCAGGGCGTCACCCGCTACGATTTGGTCCAGTTGGCGAGCAACGATCCCATTGAGGATGACCAT
GCGGAGCAGATTATACAATTTCCGGCTCGTAAGGGCGAGCAGGACGCGTCCAGGGACTGGATGTTCTGGGGTGTC
TACGATGGCCATTCAGGATGGACCACATCCGCCACTCTGCGCAGGAGTCTTATTAGTTACGTCGCCAGAGAGCTC
AACAACACGTACATGGCCGCCAAGAATGATTCGCCGTCCGCCGAAGCCGTCGACTTGGCCATCAAGACGGGCTTC
AACAGGCTAGACCACGACATCGTTCACAAGAGCGTCGAAAAGGTCTTCAAATCCAATTCCAAGCCCGTGGCTGCC
GGCTTGCTGCAACCCGCCTTGTCCGGCTCGTGTGCCCTCCTGTCATTTTACGATAGCAAGACCAAGCTCCTGCGG
GTGGCCTGCACTGGCGACTCGCGTGCCGTGCTGGGCCGCCGCTCCGAGTCTGGCATGTGGACGGCTTCGGCGCTG
TCTGAGGACCAGACGGGAAGCACGCCGAGCGAGGCATCGCGGATGCGTCGTGAACACCCTGGGGAGGAATACGTC
GTCCGCAACGGCCGGGTCCTAGGCGGCTTGGAGCCGACGCGAGCATTTGGAGACGCCGTGTACAAATGGAGCAGG
GAAGTGGCCGGCAAGTTGCGCGAGAGCTTCTTTGGCCGCAGCCCGTCGCCGTTACTCAAGACGCCACCTTATGTC
ACGGCCGAGCCCGTGGTGACGACGACACGCATCGATCCCGACAAAGGCGACTTCCTCGTCCTCGCAACCGACGGT
CTGTGGGAGATGCTCACCAACGAAGAGGTTGTCGGTCTGGTTGGGAAGTGGATCGAGGCTCAGTCCGCTCCTGAG
GAGGGCACTTCACAGTTCCGCAAGGCCTGGGCCAACGTCTTCGGCTTTCCTGCGAAGCCGCTACCCGTCGAACAG
CAGCAGTCGCGCGATGGCGCTCAAGGGCAGAAGACGCCCATTCGCCTCTTGCAGTGGGGGGTCAGTCCAGATGCC
AAGGATCGCTTCACCGTCCGTGACAACAATGTGGCCACGCATCTCGTCCGCAACGCTCTCGGTGGCAACGACAAC
GAGCTACTTCGCGCTCTACTCACCCTTCCAGCGCCCTTTTCGCGGAGATATCGGGACGACCTCACTGTTCAGGTC
ATCTTCTTCGGCAACGGCGAGAAGACGGGCGACGTGACGCTCAACCTCGACGCCACGTACGAGCCAGACCCGCCC
AAGGCCGAGCTCTAG
Transcript >Ophcf2|01846
ATGCACCGCGCTGCCCTTGGGGCCCTCCGAACGACGTCGAAGTACTTCGGCGCCGCAAGGCACGTGGCACGCGCA
CGCCTGACGACGCACCGCCTTCGGCTGCCCGTGCCCCCTGACGCTGCCCCGTTGCCTCTCCGGTCTTCCATGTAT
TTCCGCAGGCTGCCAGCCCTCCTCATCTCGGGCATCGTCATCGGCTACGGCGCCTGGTACTCGCTCAACGACACC
GACGGCCGCTTCGGAAGCTTCACGTCCTCAACGCAGGCCTTTACCTCTCAGCAAACGACGGGACGCAGTGTGCTC
GTCATTGGCGATGACGAGCTGACGCAGGCCACCGTCATTGGCGACAAGCCCATCTCGAAGGCCACGACAGAGGAC
GGACAGAAGGTTGTCGATATGTTGACGCCCGAGCAGGCTACGCGCAAGCTGCGTCGGGAGGAGAAGTCTTTCTCC
GTTAACCGGGGCCAGGGCGTCACCCGCTACGATTTGGTCCAGTTGGCGAGCAACGATCCCATTGAGGATGACCAT
GCGGAGCAGATTATACAATTTCCGGCTCGTAAGGGCGAGCAGGACGCGTCCAGGGACTGGATGTTCTGGGGTGTC
TACGATGGCCATTCAGGATGGACCACATCCGCCACTCTGCGCAGGAGTCTTATTAGTTACGTCGCCAGAGAGCTC
AACAACACGTACATGGCCGCCAAGAATGATTCGCCGTCCGCCGAAGCCGTCGACTTGGCCATCAAGACGGGCTTC
AACAGGCTAGACCACGACATCGTTCACAAGAGCGTCGAAAAGGTCTTCAAATCCAATTCCAAGCCCGTGGCTGCC
GGCTTGCTGCAACCCGCCTTGTCCGGCTCGTGTGCCCTCCTGTCATTTTACGATAGCAAGACCAAGCTCCTGCGG
GTGGCCTGCACTGGCGACTCGCGTGCCGTGCTGGGCCGCCGCTCCGAGTCTGGCATGTGGACGGCTTCGGCGCTG
TCTGAGGACCAGACGGGAAGCACGCCGAGCGAGGCATCGCGGATGCGTCGTGAACACCCTGGGGAGGAATACGTC
GTCCGCAACGGCCGGGTCCTAGGCGGCTTGGAGCCGACGCGAGCATTTGGAGACGCCGTGTACAAATGGAGCAGG
GAAGTGGCCGGCAAGTTGCGCGAGAGCTTCTTTGGCCGCAGCCCGTCGCCGTTACTCAAGACGCCACCTTATGTC
ACGGCCGAGCCCGTGGTGACGACGACACGCATCGATCCCGACAAAGGCGACTTCCTCGTCCTCGCAACCGACGGT
CTGTGGGAGATGCTCACCAACGAAGAGGTTGTCGGTCTGGTTGGGAAGTGGATCGAGGCTCAGTCCGCTCCTGAG
GAGGGCACTTCACAGTTCCGCAAGGCCTGGGCCAACGTCTTCGGCTTTCCTGCGAAGCCGCTACCCGTCGAACAG
CAGCAGTCGCGCGATGGCGCTCAAGGGCAGAAGACGCCCATTCGCCTCTTGCAGTGGGGGGTCAGTCCAGATGCC
AAGGATCGCTTCACCGTCCGTGACAACAATGTGGCCACGCATCTCGTCCGCAACGCTCTCGGTGGCAACGACAAC
GAGCTACTTCGCGCTCTACTCACCCTTCCAGCGCCCTTTTCGCGGAGATATCGGGACGACCTCACTGTTCAGGTC
ATCTTCTTCGGCAACGGCGAGAAGACGGGCGACGTGACGCTCAACCTCGACGCCACGTACGAGCCAGACCCGCCC
AAGGCCGAGCTCTAG
Gene >Ophcf2|01846
ATGCACCGCGCTGCCCTTGGGGCCCTCCGAACGACGTCGAAGTACTTCGGCGCCGCAAGGCACGTGGCACGCGCA
CGCCTGACGACGCACCGCCTTCGGCTGCCCGTGCCCCCTGACGCTGCCCCGTTGCCTCTCCGGTCTTCCATGTAT
TTCCGCAGGCTGCCAGCCCTCCTCATCTCGGGCATCGTCATCGGCTACGGCGCCTGGTACTCGCTCAACGACACC
GACGGCCGCTTCGGAAGCTTCACGTCCTCAACGCAGGCCTTTACCTCTCAGCAAACGACGGGACGCAGTGTGCTC
GTCATTGGCGATGACGAGCTGACGCAGGCCACCGTCATTGGCGACAAGCCCATCTCGAAGGCCACGACAGAGGAC
GGACAGAAGGTTGTCGATATGTTGACGCCCGAGCAGGCTACGCGCAAGCTGCGTCGGGAGGAGAAGTCTTTCTCC
GTTAACCGGGGCCAGGGCGTCACCCGCTACGATTTGGTCCAGTTGGCGAGCAACGATCCCATTGAGGATGACCAT
GCGGAGCAGATTATACAATTTCCGGCTCGTAAGGGCGAGCAGGACGCGTCCAGGGACTGGATGTTCTGGGGTGTC
TACGATGGCCATTCGTAAGTTGTGCTCTGGCCATGGTGATGATGTGCATAACCCTCGACTCTGACCTCTTCTTCT
CTGCTCTTCAGAGGATGGACCACATCCGCCACTCTGCGCAGGAGTCTTATTAGTTACGTCGCCAGAGAGCTCAAC
AACACGTACATGGCCGCCAAGAATGATTCGCCGTCCGCCGAAGCCGTCGACTTGGCCATCAAGACGGGCTTCAAC
AGGCTAGACCACGACATCGTTCACAAGAGCGTCGAAAAGGTCTTCAAATCCAATTCCAAGCCCGTGGCTGCCGGC
TTGCTGCAACCCGCCTTGTCCGGCTCGTGTGCCCTCCTGTCATTTTACGATAGCAAGACCAAGCTCCTGCGGGTG
GCCTGCACTGGCGACTCGCGTGCCGTGCTGGGCCGCCGCTCCGAGTCTGGCATGTGGACGGCTTCGGCGCTGTCT
GAGGACCAGACGGGAAGCACGCCGAGCGAGGCATCGCGGATGCGTCGTGAACACCCTGGGGAGGAATACGTCGTC
CGCAACGGCCGGGTCCTAGGCGGCTTGGAGCCGACGCGAGCATTTGGAGACGCCGTGTACAAATGGAGCAGGGAA
GTGGCCGGCAAGTTGCGCGAGAGCTTCTTTGGCCGCAGCCCGTCGCCGTTACTCAAGACGCCACCTTATGTCACG
GCCGAGCCCGTGGTGACGACGACACGCATCGATCCCGACAAAGGCGACTTCCTCGTCCTCGCAACCGACGGTCTG
TGGGAGATGCTCACCAACGAAGAGGTTGTCGGTCTGGTTGGGAAGTGGATCGAGGCTCAGTCCGCTCCTGAGGAG
GGCACTTCACAGTTCCGCAAGGCCTGGGCCAACGTCTTCGGCTTTCCTGCGAAGCCGCTACCCGTCGAACAGCAG
CAGTCGCGCGATGGCGCTCAAGGGCAGAAGACGCCCATTCGCCTCTTGCAGTGGGGGGTCAGTCCAGATGCCAAG
GATCGCTTCACCGTCCGTGACAACAATGTGGCCACGCATCTCGTCCGCAACGCTCTCGGTGGCAACGACAACGAG
CTACTTCGCGCTCTACTCACCCTTCCAGCGCCCTTTTCGCGGAGATATCGGTGAGTCTAGGGATAATGGAACGTC
CGTTCCTTTATTGAACGCTTGTTGACCGGTCATCCATCTCAGGGACGACCTCACTGTTCAGGTCATCTTCTTCGG
CAACGGCGAGAAGACGGGCGACGTGACGCTCAACCTCGACGCCACGTACGAGCCAGACCCGCCCAAGGCCGAGCT
CTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail