Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01845
Gene name
Locationscaffold_02:1890627..1891441
Strand-
Gene length (bp)814
Transcript length (bp)615
Coding sequence length (bp)615
Protein length (aa) 205

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17733 DUF5572 Family of unknown function (DUF5572) 7.4E-17 122 170

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.7052 0.4486 0.017 0.0287 0.1044 0.0083 0.0952 0.068 0.0987 0.1098

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3042
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3467
Ophiocordyceps australis map64 (Brazil) OphauB2|3321
Ophiocordyceps camponoti-floridani Ophcf2|01845 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|233
Ophiocordyceps kimflemingae Ophio5|2840
Ophiocordyceps subramaniannii Hirsu2|5269

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01845
MAQSPAPSDSLSTIRSLQDQDSIYQAFDSYPWSKDNTFLSGLSAILGESGTGTPQGSPQDIATHARVFYYAQRVG
VQIDFAQYQAWLAQNPDHKPPDKAAPKADLYVERSASSQNSSGEPNYPIGFAEMLKLLKDGKPVPGIKQIPNTVA
RGPAVKPVGSRAAPRKPWEKKNDFRQPPDADLPKVLDDEFPAINAAALAPPSEQ*
Coding >Ophcf2|01845
ATGGCCCAGTCCCCCGCTCCTTCAGACTCCCTCTCCACCATCCGCTCGCTCCAGGACCAAGACTCAATTTACCAG
GCCTTCGACAGCTATCCCTGGTCCAAGGACAACACCTTTCTCTCTGGCCTGTCCGCCATCCTTGGCGAGTCCGGT
ACAGGCACCCCGCAAGGCTCGCCACAAGATATCGCCACCCATGCCCGCGTCTTTTACTACGCCCAGCGTGTAGGT
GTGCAGATCGATTTCGCCCAGTATCAAGCCTGGCTGGCTCAGAACCCCGATCATAAGCCTCCCGATAAGGCTGCT
CCAAAGGCCGACCTCTACGTTGAAAGGTCCGCCTCTTCTCAAAATTCTTCCGGAGAGCCCAATTATCCCATCGGA
TTCGCCGAAATGCTCAAGTTGCTGAAAGACGGCAAGCCTGTTCCTGGCATCAAACAGATCCCAAACACAGTTGCC
AGGGGTCCGGCTGTTAAGCCAGTCGGCTCCCGCGCGGCACCTAGGAAGCCTTGGGAGAAGAAGAACGATTTTCGT
CAGCCCCCCGACGCTGATCTGCCCAAAGTTCTTGACGACGAGTTCCCGGCCATCAACGCCGCCGCCCTTGCACCA
CCTTCCGAACAATGA
Transcript >Ophcf2|01845
ATGGCCCAGTCCCCCGCTCCTTCAGACTCCCTCTCCACCATCCGCTCGCTCCAGGACCAAGACTCAATTTACCAG
GCCTTCGACAGCTATCCCTGGTCCAAGGACAACACCTTTCTCTCTGGCCTGTCCGCCATCCTTGGCGAGTCCGGT
ACAGGCACCCCGCAAGGCTCGCCACAAGATATCGCCACCCATGCCCGCGTCTTTTACTACGCCCAGCGTGTAGGT
GTGCAGATCGATTTCGCCCAGTATCAAGCCTGGCTGGCTCAGAACCCCGATCATAAGCCTCCCGATAAGGCTGCT
CCAAAGGCCGACCTCTACGTTGAAAGGTCCGCCTCTTCTCAAAATTCTTCCGGAGAGCCCAATTATCCCATCGGA
TTCGCCGAAATGCTCAAGTTGCTGAAAGACGGCAAGCCTGTTCCTGGCATCAAACAGATCCCAAACACAGTTGCC
AGGGGTCCGGCTGTTAAGCCAGTCGGCTCCCGCGCGGCACCTAGGAAGCCTTGGGAGAAGAAGAACGATTTTCGT
CAGCCCCCCGACGCTGATCTGCCCAAAGTTCTTGACGACGAGTTCCCGGCCATCAACGCCGCCGCCCTTGCACCA
CCTTCCGAACAATGA
Gene >Ophcf2|01845
ATGGCCCAGTCCCCCGCTCCTTCAGACTCCCTCTCCACCATCCGCTCGCTCCAGGACCAAGACTCAATTTACCAG
GCCTTCGACAGCTATCCCTGGTCCAAGGACAACACCTTTCTCGTACGTGCCACCTCGAATAAGCTCTTCATGGCT
TCTCACATGCCCAGTCTGGCCTGTCCGCCATCCTTGGCGAGTCCGGTACAGGCACCCCGCAAGGCTCGCCACAAG
ATATCGCCACCCATGCCCGCGTCTTTTACTACGCCCAGCGTGTAGGTGTGCAGATCGATTTCGCCCAGTATCAAG
CCTGGCTGGCTCAGAACCCCGATCATAAGCCTCCCGATGTCATTCCCACCCTCAGCTATTCCCCCACCCCTCCTC
TTCCTCTCCACAGCCGGAGCCCCCCCGCTCGGTCTTGCATTGGCAGAAGGCTGCTCCAAAGGCCGACCTCTACGT
TGAAAGGTCCGCCTCTTCTCAAAATTCTTCCGGAGAGCCCAATTATCCCATCGGATTCGCCGAAATGCTCAAGTT
GCTGAAAGACGGCAAGCCTGTTCCTGGCATCAAACAGATCCCAAACACAGTTGCCAGGGGTCCGGTATGCTCCCA
TGCAACCATGTTTTCAAGTCGCCTCCATCCAGTAGGCAGGGCTGACCCGCCTCCGTAGGCTGTTAAGCCAGTCGG
CTCCCGCGCGGCACCTAGGAAGCCTTGGGAGAAGAAGAACGATTTTCGTCAGCCCCCCGACGCTGATCTGCCCAA
AGTTCTTGACGACGAGTTCCCGGCCATCAACGCCGCCGCCCTTGCACCACCTTCCGAACAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail