Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01844
Gene name
Locationscaffold_02:1887186..1889822
Strand+
Gene length (bp)2636
Transcript length (bp)2343
Coding sequence length (bp)2343
Protein length (aa) 781

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00806 PUF Pumilio-family RNA binding repeat 1.3E-01 438 464
PF00806 PUF Pumilio-family RNA binding repeat 7.1E-07 467 499
PF00806 PUF Pumilio-family RNA binding repeat 5.4E-10 505 537
PF00806 PUF Pumilio-family RNA binding repeat 1.4E-01 545 558
PF00806 PUF Pumilio-family RNA binding repeat 3.1E-04 582 613
PF00806 PUF Pumilio-family RNA binding repeat 1.3E-01 623 648
PF00806 PUF Pumilio-family RNA binding repeat 2.6E-01 653 670
PF00806 PUF Pumilio-family RNA binding repeat 6.7E-06 698 728

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.8073 0.3336 0.2441 0.0681 0.1507 0.0023 0.0628 0.1177 0.0375 0.0104

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3041
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3466
Ophiocordyceps australis map64 (Brazil) OphauB2|3320
Ophiocordyceps camponoti-floridani Ophcf2|01844 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|234
Ophiocordyceps kimflemingae Ophio5|2837
Ophiocordyceps subramaniannii Hirsu2|5268

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01844
MSPPESSASSTPQRGAAVQSEVVYGDTFTHDIVADSAAAHDTNIGSSASVTSTFLASTANKQPAQGTPKMSQSSP
AATDSYSVDKILARFTEQQLVLDHQGDVFKRTDGDAVGNANGAGSIFSRNLDHASSSSSLPLTPATDGFPATAPA
TRPASATLDEARPEADEVLHLKLQLAQAQSQISKLGQELARSHSTKTDPDLQCTGMPRNLPSLSRESTWMATDDS
QSDSSDAMSSTAFNRARGIWGNPKATFSNPSLPVPVPAIEPSPWTGGRVFNQGYADAGGQFSAGDGYRGERLTTD
SDLLTRPSASRRGQRLDNRLGAPHQYGGGFGGMTGPVGHFDSISTPMPLPSNTMSVAPGLAPMSMGVFPPYQQQP
IGTTLSPHASEFTSNAAWKNETMSPDAPTYLPATEPLNYRRLLDKNVSANWKYIVDKIVCNNDQQASIFLQQKLK
VGSPEQKYDIVEAIVAQAYPLMVNRFGNFLVQRCFEHGTPEQVIKIATAIRGNTLNLSMDPFGCHVVQKAFDSVP
EEYKAIMVHELLRRIPETVIHRYACHVWQKLFELRWTESPPQIMKFVNEALRGMWHEVALGETGSLVVQNIFENC
LEEDKRPCIEEVLANIDIVAHGQFGNWCIQHVCEHGAPPDRSRAVDHVIRYAAEYSTDQFASKVVEKCLKIGGAD
FLGRYLGRVCEGRRDRTRIPLIDIASDQYGNYLVQWILNNASPQHREMVAAHIRKHMVSLRGSKFGSRVGMLCTN
HAVTTRPGPGVGPGIGGRMGPGPRFGGSYR*
Coding >Ophcf2|01844
ATGTCGCCTCCTGAATCCTCTGCTTCGTCGACTCCTCAGCGAGGAGCTGCTGTCCAGTCTGAGGTCGTTTATGGG
GATACGTTCACTCACGACATTGTCGCCGATTCCGCAGCGGCTCACGACACTAACATCGGCTCGAGTGCGTCAGTG
ACAAGCACGTTTTTGGCTTCGACTGCGAATAAGCAGCCTGCTCAAGGCACTCCAAAGATGAGCCAGTCCAGCCCT
GCTGCCACGGATTCCTACTCGGTAGATAAGATACTCGCCAGGTTCACCGAGCAGCAGCTTGTTCTTGATCATCAA
GGCGACGTCTTCAAACGGACCGACGGCGACGCAGTCGGCAACGCCAACGGCGCCGGCAGCATCTTTTCGAGAAAC
TTGGATCACGCCTCGTCGAGCAGCTCTCTGCCACTCACTCCGGCTACTGACGGATTTCCCGCCACGGCCCCCGCC
ACCCGCCCTGCGAGTGCTACGCTTGACGAAGCTCGGCCTGAGGCGGACGAGGTGTTGCACCTGAAGCTGCAGCTT
GCTCAGGCTCAGAGTCAGATTTCGAAGCTTGGGCAAGAGCTGGCAAGATCGCACTCGACAAAGACCGACCCCGAT
CTTCAGTGTACTGGAATGCCTCGGAACTTGCCCTCGCTTTCTCGCGAGTCTACCTGGATGGCGACAGACGATTCC
CAGTCTGACAGTAGCGACGCCATGTCGTCCACGGCATTCAATCGAGCTCGGGGGATATGGGGGAACCCCAAGGCT
ACCTTCAGCAACCCATCCCTTCCGGTCCCAGTACCGGCTATTGAGCCATCGCCCTGGACGGGAGGCCGTGTCTTC
AACCAGGGATACGCAGACGCTGGTGGCCAGTTTTCCGCCGGGGACGGATACCGGGGAGAACGCCTCACCACCGAC
TCGGACCTTCTTACGCGTCCGTCGGCCAGCCGTCGAGGTCAGCGCCTTGACAATCGACTAGGTGCGCCTCACCAG
TATGGAGGAGGCTTTGGCGGCATGACTGGACCCGTGGGACACTTCGACTCGATTTCCACTCCCATGCCCTTGCCC
TCCAACACAATGAGCGTCGCCCCGGGGTTGGCTCCCATGAGCATGGGCGTGTTTCCTCCTTATCAGCAACAGCCC
ATCGGAACGACTCTCTCACCACACGCTTCAGAGTTCACATCAAACGCTGCTTGGAAGAACGAGACCATGTCTCCG
GATGCCCCGACCTACCTGCCCGCCACGGAGCCTCTCAATTACCGCAGGCTGCTGGATAAGAATGTGAGTGCCAAT
TGGAAATACATCGTGGATAAGATTGTTTGCAACAACGACCAGCAAGCCTCCATCTTCCTCCAGCAGAAACTCAAG
GTGGGGAGCCCGGAGCAAAAGTATGATATAGTCGAGGCCATCGTGGCCCAGGCCTATCCCCTGATGGTCAACCGG
TTCGGCAATTTCCTGGTCCAACGATGCTTCGAGCACGGCACCCCAGAGCAGGTCATCAAGATTGCCACGGCGATA
CGCGGCAACACGCTGAACCTGTCCATGGACCCCTTCGGCTGCCACGTGGTGCAGAAGGCATTCGATTCGGTGCCA
GAAGAGTACAAGGCCATCATGGTTCATGAGCTGCTTCGGCGGATCCCCGAGACGGTGATCCATCGATATGCCTGT
CACGTGTGGCAAAAGCTATTTGAGCTTCGCTGGACTGAGTCGCCTCCTCAGATCATGAAATTTGTCAATGAAGCG
CTCAGAGGCATGTGGCACGAGGTTGCGTTGGGAGAGACTGGAAGCCTCGTCGTCCAGAACATCTTTGAGAACTGC
CTCGAGGAAGACAAGCGTCCTTGCATCGAAGAGGTGCTTGCCAACATCGACATCGTGGCACATGGTCAGTTTGGC
AACTGGTGTATCCAGCACGTTTGCGAGCACGGCGCGCCTCCGGACAGAAGCCGGGCCGTCGACCACGTCATCCGC
TACGCGGCCGAGTACAGCACCGACCAGTTCGCCTCGAAGGTGGTGGAAAAGTGTCTCAAGATTGGCGGCGCCGAC
TTCTTGGGCCGGTACCTGGGTCGAGTTTGCGAAGGCCGGCGGGACCGAACGCGGATCCCTCTCATTGACATCGCG
AGCGACCAGTACGGCAACTATCTGGTTCAGTGGATCCTCAACAACGCGTCGCCCCAGCATCGCGAAATGGTGGCC
GCCCACATCCGCAAGCACATGGTGTCTCTACGGGGCTCCAAATTTGGTTCTCGCGTCGGCATGCTGTGCACCAAC
CACGCCGTCACCACTCGCCCGGGGCCGGGCGTCGGGCCGGGCATCGGTGGCCGCATGGGTCCAGGACCGCGGTTC
GGGGGCTCGTACCGTTAA
Transcript >Ophcf2|01844
ATGTCGCCTCCTGAATCCTCTGCTTCGTCGACTCCTCAGCGAGGAGCTGCTGTCCAGTCTGAGGTCGTTTATGGG
GATACGTTCACTCACGACATTGTCGCCGATTCCGCAGCGGCTCACGACACTAACATCGGCTCGAGTGCGTCAGTG
ACAAGCACGTTTTTGGCTTCGACTGCGAATAAGCAGCCTGCTCAAGGCACTCCAAAGATGAGCCAGTCCAGCCCT
GCTGCCACGGATTCCTACTCGGTAGATAAGATACTCGCCAGGTTCACCGAGCAGCAGCTTGTTCTTGATCATCAA
GGCGACGTCTTCAAACGGACCGACGGCGACGCAGTCGGCAACGCCAACGGCGCCGGCAGCATCTTTTCGAGAAAC
TTGGATCACGCCTCGTCGAGCAGCTCTCTGCCACTCACTCCGGCTACTGACGGATTTCCCGCCACGGCCCCCGCC
ACCCGCCCTGCGAGTGCTACGCTTGACGAAGCTCGGCCTGAGGCGGACGAGGTGTTGCACCTGAAGCTGCAGCTT
GCTCAGGCTCAGAGTCAGATTTCGAAGCTTGGGCAAGAGCTGGCAAGATCGCACTCGACAAAGACCGACCCCGAT
CTTCAGTGTACTGGAATGCCTCGGAACTTGCCCTCGCTTTCTCGCGAGTCTACCTGGATGGCGACAGACGATTCC
CAGTCTGACAGTAGCGACGCCATGTCGTCCACGGCATTCAATCGAGCTCGGGGGATATGGGGGAACCCCAAGGCT
ACCTTCAGCAACCCATCCCTTCCGGTCCCAGTACCGGCTATTGAGCCATCGCCCTGGACGGGAGGCCGTGTCTTC
AACCAGGGATACGCAGACGCTGGTGGCCAGTTTTCCGCCGGGGACGGATACCGGGGAGAACGCCTCACCACCGAC
TCGGACCTTCTTACGCGTCCGTCGGCCAGCCGTCGAGGTCAGCGCCTTGACAATCGACTAGGTGCGCCTCACCAG
TATGGAGGAGGCTTTGGCGGCATGACTGGACCCGTGGGACACTTCGACTCGATTTCCACTCCCATGCCCTTGCCC
TCCAACACAATGAGCGTCGCCCCGGGGTTGGCTCCCATGAGCATGGGCGTGTTTCCTCCTTATCAGCAACAGCCC
ATCGGAACGACTCTCTCACCACACGCTTCAGAGTTCACATCAAACGCTGCTTGGAAGAACGAGACCATGTCTCCG
GATGCCCCGACCTACCTGCCCGCCACGGAGCCTCTCAATTACCGCAGGCTGCTGGATAAGAATGTGAGTGCCAAT
TGGAAATACATCGTGGATAAGATTGTTTGCAACAACGACCAGCAAGCCTCCATCTTCCTCCAGCAGAAACTCAAG
GTGGGGAGCCCGGAGCAAAAGTATGATATAGTCGAGGCCATCGTGGCCCAGGCCTATCCCCTGATGGTCAACCGG
TTCGGCAATTTCCTGGTCCAACGATGCTTCGAGCACGGCACCCCAGAGCAGGTCATCAAGATTGCCACGGCGATA
CGCGGCAACACGCTGAACCTGTCCATGGACCCCTTCGGCTGCCACGTGGTGCAGAAGGCATTCGATTCGGTGCCA
GAAGAGTACAAGGCCATCATGGTTCATGAGCTGCTTCGGCGGATCCCCGAGACGGTGATCCATCGATATGCCTGT
CACGTGTGGCAAAAGCTATTTGAGCTTCGCTGGACTGAGTCGCCTCCTCAGATCATGAAATTTGTCAATGAAGCG
CTCAGAGGCATGTGGCACGAGGTTGCGTTGGGAGAGACTGGAAGCCTCGTCGTCCAGAACATCTTTGAGAACTGC
CTCGAGGAAGACAAGCGTCCTTGCATCGAAGAGGTGCTTGCCAACATCGACATCGTGGCACATGGTCAGTTTGGC
AACTGGTGTATCCAGCACGTTTGCGAGCACGGCGCGCCTCCGGACAGAAGCCGGGCCGTCGACCACGTCATCCGC
TACGCGGCCGAGTACAGCACCGACCAGTTCGCCTCGAAGGTGGTGGAAAAGTGTCTCAAGATTGGCGGCGCCGAC
TTCTTGGGCCGGTACCTGGGTCGAGTTTGCGAAGGCCGGCGGGACCGAACGCGGATCCCTCTCATTGACATCGCG
AGCGACCAGTACGGCAACTATCTGGTTCAGTGGATCCTCAACAACGCGTCGCCCCAGCATCGCGAAATGGTGGCC
GCCCACATCCGCAAGCACATGGTGTCTCTACGGGGCTCCAAATTTGGTTCTCGCGTCGGCATGCTGTGCACCAAC
CACGCCGTCACCACTCGCCCGGGGCCGGGCGTCGGGCCGGGCATCGGTGGCCGCATGGGTCCAGGACCGCGGTTC
GGGGGCTCGTACCGTTAA
Gene >Ophcf2|01844
ATGTCGCCTCCTGAATCCTCTGCTTCGTCGACTCCTCAGCGAGGAGCTGCTGTCCAGTCTGAGGTCGTTTATGGG
GATACGTTCACTCACGACATTGTCGCCGATTCCGCAGCGGCTCACGACACTGTGAGTTTCTTCAGGCTTCCTCTC
CCACCCGTCTACCCCTATTGTTTTTGCCCTTCACTTCACTTCTGATCGCGTGGCTCATCAATGGTGCGAGTAGAA
CATCGGCTCGAGTGCGTCAGTGACAAGCACGTTTTTGGCTTCGACTGCGAATAAGCAGCCTGCTCAAGGCACTCC
AAAGGTTCGTTGATTTTTGGTTCTACGTGAAATTCTTGCCGTGACTACTGACAAATCGTTTTCCAAGATGAGCCA
GTCCAGCCCTGCTGCCACGGATTCCTACTCGGTAGATAAGATACTCGCCAGGTTCACCGAGCAGCAGCTTGTTCT
TGATCATCAAGGCGACGTCTTCAAACGGACCGACGGCGACGCAGTCGGCAACGCCAACGGCGCCGGCAGCATCTT
TTCGAGAAACTTGGATCACGCCTCGTCGAGCAGCTCTCTGCCACTCACTCCGGCTACTGACGGATTTCCCGCCAC
GGCCCCCGCCACCCGCCCTGCGAGTGCTACGCTTGACGAAGCTCGGCCTGAGGCGGACGAGGTGTTGCACCTGAA
GCTGCAGCTTGCTCAGGCTCAGAGTCAGATTTCGAAGCTTGGGCAAGAGCTGGCAAGATCGCACTCGACAAAGAC
CGACCCCGATCTTCAGTGTACTGGAATGCCTCGGAACTTGCCCTCGCTTTCTCGCGAGTCTACCTGGATGGCGAC
AGACGATTCCCAGTCTGACAGTAGCGACGCCATGTCGTCCACGGCATTCAATCGAGCTCGGGGGATATGGGGGAA
CCCCAAGGCTACCTTCAGCAACCCATCCCTTCCGGTCCCAGTACCGGCTATTGAGCCATCGCCCTGGACGGGAGG
CCGTGTCTTCAACCAGGGATACGCAGACGCTGGTGGCCAGTTTTCCGCCGGGGACGGATACCGGGGAGAACGCCT
CACCACCGACTCGGACCTTCTTACGCGTCCGTCGGCCAGCCGTCGAGGTCAGCGCCTTGACAATCGACTAGGTGC
GCCTCACCAGTATGGAGGAGGCTTTGGCGGCATGACTGGACCCGTGGGACACTTCGACTCGATTTCCACTCCCAT
GCCCTTGCCCTCCAACACAATGAGCGTCGCCCCGGGGTTGGCTCCCATGAGCATGGGCGTGTTTCCTCCTTATCA
GCAACAGCCCATCGGAACGACTCTCTCACCACACGCTTCAGAGTTCACATCAAACGCTGCTTGGAAGAACGAGGT
GAGCAAGATGCTGAACCGTCTGCCTGTGGTTGTGACAGCTTCACGAGCGGTTATGAACCTGACGAATCCCCAGAC
CATGTCTCCGGATGCCCCGACCTACCTGCCCGCCACGGAGCCTCTCAATTACCGCAGGCTGCTGGATAAGAATGT
GAGTGCCAATTGGAAATACATCGTGGATAAGATTGTTTGCAACAACGACCAGCAAGCCTCCATCTTCCTCCAGCA
GAAACTCAAGGTGGGGAGCCCGGAGCAAAAGTATGATATAGTCGAGGCCATCGTGGCCCAGGCCTATCCCCTGAT
GGTCAACCGGTTCGGCAATTTCCTGGTCCAACGATGCTTCGAGCACGGCACCCCAGAGCAGGTCATCAAGATTGC
CACGGCGATACGCGGCAACACGCTGAACCTGTCCATGGACCCCTTCGGCTGCCACGTGGTGCAGAAGGCATTCGA
TTCGGTGCCAGAAGAGTACAAGGCCATCATGGTTCATGAGCTGCTTCGGCGGATCCCCGAGACGGTGATCCATCG
ATATGCCTGTCACGTGTGGCAAAAGCTATTTGAGCTTCGCTGGACTGAGTCGCCTCCTCAGATCATGAAATTTGT
CAATGAAGCGCTCAGAGGCATGTGGCACGAGGTTGCGTTGGGAGAGACTGGAAGCCTCGTCGTCCAGAACATCTT
TGAGAACTGCCTCGAGGAAGACAAGGTAAGATGGTAGCCATCGCGCCTGTGACAATAATTTGGTGCTGACTCTGT
GTCTGCAGCGTCCTTGCATCGAAGAGGTGCTTGCCAACATCGACATCGTGGCACATGGTCAGTTTGGCAACTGGT
GTATCCAGCACGTTTGCGAGCACGGCGCGCCTCCGGACAGAAGCCGGGCCGTCGACCACGTCATCCGCTACGCGG
CCGAGTACAGCACCGACCAGTTCGCCTCGAAGGTGGTGGAAAAGTGTCTCAAGATTGGCGGCGCCGACTTCTTGG
GCCGGTACCTGGGTCGAGTTTGCGAAGGCCGGCGGGACCGAACGCGGATCCCTCTCATTGACATCGCGAGCGACC
AGTACGGCAACTATCTGGTTCAGTGGATCCTCAACAACGCGTCGCCCCAGCATCGCGAAATGGTGGCCGCCCACA
TCCGCAAGCACATGGTGTCTCTACGGGGCTCCAAATTTGGTTCTCGCGTCGGCATGCTGTGCACCAACCACGCCG
TCACCACTCGCCCGGGGCCGGGCGTCGGGCCGGGCATCGGTGGCCGCATGGGTCCAGGACCGCGGTTCGGGGGCT
CGTACCGTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail