Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01838
Gene name
Locationscaffold_02:1865294..1865784
Strand+
Gene length (bp)490
Transcript length (bp)429
Coding sequence length (bp)429
Protein length (aa) 143

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10937 S36_mt Ribosomal protein S36, mitochondrial 1.6E-41 18 137

GO

GO Term Description Terminal node
GO:0009353 mitochondrial oxoglutarate dehydrogenase complex Yes
GO:0006103 2-oxoglutarate metabolic process Yes
GO:0045240 dihydrolipoyl dehydrogenase complex No
GO:0044237 cellular metabolic process No
GO:1990234 transferase complex No
GO:0009987 cellular process No
GO:0043436 oxoacid metabolic process No
GO:0098798 mitochondrial protein-containing complex No
GO:0045252 oxoglutarate dehydrogenase complex No
GO:0019752 carboxylic acid metabolic process No
GO:0005947 mitochondrial alpha-ketoglutarate dehydrogenase complex No
GO:0008152 metabolic process No
GO:0032991 protein-containing complex No
GO:0071704 organic substance metabolic process No
GO:0044281 small molecule metabolic process No
GO:1990204 oxidoreductase complex No
GO:0005575 cellular_component No
GO:0045239 tricarboxylic acid cycle enzyme complex No
GO:0030062 mitochondrial tricarboxylic acid cycle enzyme complex No
GO:0006082 organic acid metabolic process No
GO:0043648 dicarboxylic acid metabolic process No
GO:0008150 biological_process No
GO:1902494 catalytic complex No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.147 0.2065 0.0273 0.1196 0.9684 0.0275 0.0421 0.0189 0.0199 0.0714

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4859
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1600
Ophiocordyceps australis map64 (Brazil) OphauB2|6730
Ophiocordyceps camponoti-floridani Ophcf2|01838 (this protein)
Ophiocordyceps kimflemingae Ophio5|3666
Ophiocordyceps subramaniannii Hirsu2|10979

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01838
MFAASRALRQAGAHADRTPMIKFLGPRTIPSSIDHTPRPHPASPSGTLPESFSAYGNGESASRHNSFSSYRDHAQ
QHGPLQKSIRGFEAGIGGTAGSQLGPVEPPKGVYFDLSDLPPRFRRVPFDMAEIEAIESGGAALYHR*
Coding >Ophcf2|01838
ATGTTCGCCGCCTCTCGAGCCCTCCGCCAGGCCGGCGCCCACGCAGACCGCACTCCCATGATCAAGTTTCTCGGC
CCCCGCACTATCCCTTCTTCAATCGACCACACGCCCAGACCTCACCCCGCCTCCCCAAGCGGAACGCTCCCAGAG
TCCTTCTCCGCCTACGGAAACGGCGAGTCCGCCTCGCGTCATAACTCTTTTAGCTCCTACCGCGACCACGCTCAG
CAACACGGCCCGCTGCAAAAGTCGATCCGCGGCTTCGAGGCCGGCATTGGCGGCACCGCCGGCTCCCAGCTGGGT
CCCGTTGAACCCCCAAAGGGCGTCTACTTCGACCTCTCCGACTTACCCCCCCGCTTCCGTCGCGTTCCCTTCGAT
ATGGCTGAGATCGAGGCCATCGAATCGGGCGGCGCTGCCCTGTACCACCGCTAA
Transcript >Ophcf2|01838
ATGTTCGCCGCCTCTCGAGCCCTCCGCCAGGCCGGCGCCCACGCAGACCGCACTCCCATGATCAAGTTTCTCGGC
CCCCGCACTATCCCTTCTTCAATCGACCACACGCCCAGACCTCACCCCGCCTCCCCAAGCGGAACGCTCCCAGAG
TCCTTCTCCGCCTACGGAAACGGCGAGTCCGCCTCGCGTCATAACTCTTTTAGCTCCTACCGCGACCACGCTCAG
CAACACGGCCCGCTGCAAAAGTCGATCCGCGGCTTCGAGGCCGGCATTGGCGGCACCGCCGGCTCCCAGCTGGGT
CCCGTTGAACCCCCAAAGGGCGTCTACTTCGACCTCTCCGACTTACCCCCCCGCTTCCGTCGCGTTCCCTTCGAT
ATGGCTGAGATCGAGGCCATCGAATCGGGCGGCGCTGCCCTGTACCACCGCTAA
Gene >Ophcf2|01838
ATGTTCGCCGCCTCTCGAGCCCTCCGCCAGGCCGGCGCCCACGCAGACCGCACTCCCATGATCAAGTTTCTCGGC
CCCCGCACTATCCCTTGTGAGTCCGCCTCCCAAATTCTCTTCATTTCAACTGACCACCTACCGATCACCTCGAAC
AGCTTCAATCGACCACACGCCCAGACCTCACCCCGCCTCCCCAAGCGGAACGCTCCCAGAGTCCTTCTCCGCCTA
CGGAAACGGCGAGTCCGCCTCGCGTCATAACTCTTTTAGCTCCTACCGCGACCACGCTCAGCAACACGGCCCGCT
GCAAAAGTCGATCCGCGGCTTCGAGGCCGGCATTGGCGGCACCGCCGGCTCCCAGCTGGGTCCCGTTGAACCCCC
AAAGGGCGTCTACTTCGACCTCTCCGACTTACCCCCCCGCTTCCGTCGCGTTCCCTTCGATATGGCTGAGATCGA
GGCCATCGAATCGGGCGGCGCTGCCCTGTACCACCGCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail