Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01833
Gene name
Locationscaffold_02:1848571..1849879
Strand-
Gene length (bp)1308
Transcript length (bp)1308
Coding sequence length (bp)1308
Protein length (aa) 436

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09350 DJC28_CD DnaJ homologue, subfamily C, member 28, conserved domain 1.2E-18 180 249

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion 0.438 0.1891 0.0459 0.1085 0.5118 0.0517 0.1856 0.0685 0.0678 0.0232

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4860
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1599
Ophiocordyceps australis map64 (Brazil) OphauB2|6729
Ophiocordyceps camponoti-floridani Ophcf2|01833 (this protein)
Ophiocordyceps kimflemingae Ophio5|3661
Ophiocordyceps subramaniannii Hirsu2|10984

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01833
MARRLEEATDEAILSGGTAGRRAVEEAGFSDELKQRLLEKVADAKFREEHRAAFIEAGLPTATGEGTRRVATAQP
WTGTEPVEDVVLRMLDDAKRPLKPESRGKFCPPAVARPPTRRRVDSAGGRVARARDQAALYSELGIGSSKGLTDA
EREEMKKEFRERFQPAARSMPVSASGLAALANERIEDAVARGQFKDLPRGKAAEADPRAASPFIDTTEYLLNRII
KRQEIVPPWIEKQQELASAARVFRQRLRNDWKRHAARTIASRGGSLEQQIARAEEYAAAEKKCDPSSQISDERTT
VPAPDEKVGTESYLFRDADWERAESAYMKLSIEQLNALTRSYNLMAPEVARKPYWTLNREMESCFADVAPQLAEE
IRQRAGARLPLRGRAVEKRRSEGFAKQWMGREDVRIHVEAAEKAYGLREWWRDVWRRWIG*
Coding >Ophcf2|01833
ATGGCGAGGCGGCTCGAGGAGGCGACCGACGAGGCCATCCTGAGCGGCGGGACCGCGGGCAGACGCGCCGTCGAA
GAAGCCGGCTTCTCGGATGAGCTCAAACAGAGGCTTCTGGAGAAAGTGGCCGACGCCAAGTTCAGGGAAGAGCAC
AGAGCGGCATTTATCGAGGCGGGGCTTCCAACGGCGACGGGCGAGGGCACGAGGCGCGTGGCCACGGCCCAGCCC
TGGACCGGGACCGAGCCGGTCGAAGATGTGGTCCTCAGGATGTTGGACGACGCGAAGAGGCCCTTGAAACCTGAG
TCGCGTGGCAAATTCTGTCCGCCGGCGGTGGCGAGGCCCCCTACTAGGCGCCGAGTCGACAGCGCCGGGGGGCGA
GTAGCTCGCGCGCGGGACCAGGCAGCCCTGTATAGTGAACTAGGAATCGGTTCCTCCAAGGGTCTGACCGATGCA
GAGAGAGAGGAGATGAAAAAGGAGTTCCGGGAGAGGTTTCAGCCGGCGGCGCGGTCGATGCCCGTCTCTGCCTCG
GGACTTGCAGCTCTAGCTAATGAAAGAATCGAGGACGCCGTTGCGCGAGGACAGTTCAAAGACTTGCCGCGCGGC
AAGGCAGCCGAGGCGGACCCTAGGGCAGCGAGTCCCTTTATCGACACGACCGAGTACCTCCTGAACAGAATCATC
AAGCGGCAAGAGATTGTGCCGCCGTGGATCGAGAAGCAGCAGGAACTCGCGAGCGCGGCGCGCGTCTTTCGCCAA
CGATTACGCAACGACTGGAAGCGCCATGCGGCGAGGACGATAGCATCTAGGGGGGGCTCGCTTGAGCAACAGATT
GCTAGAGCGGAAGAGTACGCGGCAGCCGAGAAAAAGTGTGATCCGTCAAGCCAAATTTCGGACGAGAGGACGACT
GTGCCGGCGCCAGACGAAAAGGTCGGCACGGAGTCCTATCTCTTCCGCGATGCGGACTGGGAGCGGGCCGAGAGC
GCGTACATGAAGCTGTCCATCGAGCAGCTCAACGCGCTGACGAGGAGCTACAATCTAATGGCGCCGGAGGTGGCG
AGGAAGCCTTACTGGACGCTGAACAGGGAGATGGAGTCTTGCTTCGCTGACGTGGCGCCGCAGCTGGCGGAGGAG
ATCAGGCAGAGGGCCGGTGCGAGGCTGCCGCTCCGTGGCCGGGCTGTTGAGAAACGACGGAGTGAGGGGTTTGCG
AAGCAGTGGATGGGGAGAGAAGACGTCAGGATTCATGTCGAGGCGGCGGAGAAGGCCTATGGGCTTAGGGAGTGG
TGGAGGGATGTATGGAGGAGGTGGATAGGGTAG
Transcript >Ophcf2|01833
ATGGCGAGGCGGCTCGAGGAGGCGACCGACGAGGCCATCCTGAGCGGCGGGACCGCGGGCAGACGCGCCGTCGAA
GAAGCCGGCTTCTCGGATGAGCTCAAACAGAGGCTTCTGGAGAAAGTGGCCGACGCCAAGTTCAGGGAAGAGCAC
AGAGCGGCATTTATCGAGGCGGGGCTTCCAACGGCGACGGGCGAGGGCACGAGGCGCGTGGCCACGGCCCAGCCC
TGGACCGGGACCGAGCCGGTCGAAGATGTGGTCCTCAGGATGTTGGACGACGCGAAGAGGCCCTTGAAACCTGAG
TCGCGTGGCAAATTCTGTCCGCCGGCGGTGGCGAGGCCCCCTACTAGGCGCCGAGTCGACAGCGCCGGGGGGCGA
GTAGCTCGCGCGCGGGACCAGGCAGCCCTGTATAGTGAACTAGGAATCGGTTCCTCCAAGGGTCTGACCGATGCA
GAGAGAGAGGAGATGAAAAAGGAGTTCCGGGAGAGGTTTCAGCCGGCGGCGCGGTCGATGCCCGTCTCTGCCTCG
GGACTTGCAGCTCTAGCTAATGAAAGAATCGAGGACGCCGTTGCGCGAGGACAGTTCAAAGACTTGCCGCGCGGC
AAGGCAGCCGAGGCGGACCCTAGGGCAGCGAGTCCCTTTATCGACACGACCGAGTACCTCCTGAACAGAATCATC
AAGCGGCAAGAGATTGTGCCGCCGTGGATCGAGAAGCAGCAGGAACTCGCGAGCGCGGCGCGCGTCTTTCGCCAA
CGATTACGCAACGACTGGAAGCGCCATGCGGCGAGGACGATAGCATCTAGGGGGGGCTCGCTTGAGCAACAGATT
GCTAGAGCGGAAGAGTACGCGGCAGCCGAGAAAAAGTGTGATCCGTCAAGCCAAATTTCGGACGAGAGGACGACT
GTGCCGGCGCCAGACGAAAAGGTCGGCACGGAGTCCTATCTCTTCCGCGATGCGGACTGGGAGCGGGCCGAGAGC
GCGTACATGAAGCTGTCCATCGAGCAGCTCAACGCGCTGACGAGGAGCTACAATCTAATGGCGCCGGAGGTGGCG
AGGAAGCCTTACTGGACGCTGAACAGGGAGATGGAGTCTTGCTTCGCTGACGTGGCGCCGCAGCTGGCGGAGGAG
ATCAGGCAGAGGGCCGGTGCGAGGCTGCCGCTCCGTGGCCGGGCTGTTGAGAAACGACGGAGTGAGGGGTTTGCG
AAGCAGTGGATGGGGAGAGAAGACGTCAGGATTCATGTCGAGGCGGCGGAGAAGGCCTATGGGCTTAGGGAGTGG
TGGAGGGATGTATGGAGGAGGTGGATAGGGTAG
Gene >Ophcf2|01833
ATGGCGAGGCGGCTCGAGGAGGCGACCGACGAGGCCATCCTGAGCGGCGGGACCGCGGGCAGACGCGCCGTCGAA
GAAGCCGGCTTCTCGGATGAGCTCAAACAGAGGCTTCTGGAGAAAGTGGCCGACGCCAAGTTCAGGGAAGAGCAC
AGAGCGGCATTTATCGAGGCGGGGCTTCCAACGGCGACGGGCGAGGGCACGAGGCGCGTGGCCACGGCCCAGCCC
TGGACCGGGACCGAGCCGGTCGAAGATGTGGTCCTCAGGATGTTGGACGACGCGAAGAGGCCCTTGAAACCTGAG
TCGCGTGGCAAATTCTGTCCGCCGGCGGTGGCGAGGCCCCCTACTAGGCGCCGAGTCGACAGCGCCGGGGGGCGA
GTAGCTCGCGCGCGGGACCAGGCAGCCCTGTATAGTGAACTAGGAATCGGTTCCTCCAAGGGTCTGACCGATGCA
GAGAGAGAGGAGATGAAAAAGGAGTTCCGGGAGAGGTTTCAGCCGGCGGCGCGGTCGATGCCCGTCTCTGCCTCG
GGACTTGCAGCTCTAGCTAATGAAAGAATCGAGGACGCCGTTGCGCGAGGACAGTTCAAAGACTTGCCGCGCGGC
AAGGCAGCCGAGGCGGACCCTAGGGCAGCGAGTCCCTTTATCGACACGACCGAGTACCTCCTGAACAGAATCATC
AAGCGGCAAGAGATTGTGCCGCCGTGGATCGAGAAGCAGCAGGAACTCGCGAGCGCGGCGCGCGTCTTTCGCCAA
CGATTACGCAACGACTGGAAGCGCCATGCGGCGAGGACGATAGCATCTAGGGGGGGCTCGCTTGAGCAACAGATT
GCTAGAGCGGAAGAGTACGCGGCAGCCGAGAAAAAGTGTGATCCGTCAAGCCAAATTTCGGACGAGAGGACGACT
GTGCCGGCGCCAGACGAAAAGGTCGGCACGGAGTCCTATCTCTTCCGCGATGCGGACTGGGAGCGGGCCGAGAGC
GCGTACATGAAGCTGTCCATCGAGCAGCTCAACGCGCTGACGAGGAGCTACAATCTAATGGCGCCGGAGGTGGCG
AGGAAGCCTTACTGGACGCTGAACAGGGAGATGGAGTCTTGCTTCGCTGACGTGGCGCCGCAGCTGGCGGAGGAG
ATCAGGCAGAGGGCCGGTGCGAGGCTGCCGCTCCGTGGCCGGGCTGTTGAGAAACGACGGAGTGAGGGGTTTGCG
AAGCAGTGGATGGGGAGAGAAGACGTCAGGATTCATGTCGAGGCGGCGGAGAAGGCCTATGGGCTTAGGGAGTGG
TGGAGGGATGTATGGAGGAGGTGGATAGGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail