Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01829
Gene name
Locationscaffold_02:1801678..1802308
Strand-
Gene length (bp)630
Transcript length (bp)630
Coding sequence length (bp)630
Protein length (aa) 210

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00830 Ribosomal_L28 Ribosomal L28 family 1.2E-11 48 104

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0005198 structural molecule activity No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1036 0.0993 0.0171 0.0608 0.9752 0.0462 0.0439 0.0316 0.0217 0.0083

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1446
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2540
Ophiocordyceps australis map64 (Brazil) OphauB2|6726
Ophiocordyceps camponoti-floridani Ophcf2|01829 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1017
Ophiocordyceps kimflemingae Ophio5|3657
Ophiocordyceps subramaniannii Hirsu2|10989

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01829
MRYPGNVFRTLSTTTPLFAKTIKPTKLPRDLVPAYPYGERRVYKQSNRGLYGHARVRYGYNVSEKWFTKSQRLWR
PNIHVKILKSKALGVRIRLRLTLRVLKTILREGGVDNYLLGTKPGRLQDLGPCGWGLRWLVMQTRAVQERFNEER
IKLGLEPKEIEDKDHIIDYVLDRATPGPLNARSRATLASLRASMADAVVCGNDSVVKLS*
Coding >Ophcf2|01829
ATGAGATATCCGGGAAACGTCTTTCGAACTTTATCCACCACCACGCCCTTATTCGCCAAAACTATCAAACCCACC
AAGCTCCCGCGGGACCTCGTGCCTGCTTACCCTTATGGCGAACGCCGCGTATACAAGCAGTCGAACCGTGGGCTC
TACGGACACGCCCGCGTCCGCTATGGCTACAATGTTTCCGAAAAGTGGTTTACCAAAAGCCAGCGGTTGTGGCGG
CCTAACATCCACGTCAAGATCCTCAAATCCAAAGCTCTCGGCGTACGCATAAGGCTCCGTCTTACGCTCCGCGTC
CTCAAGACGATCCTACGTGAGGGCGGTGTGGACAATTACCTTCTGGGGACAAAGCCAGGCCGGCTCCAAGACCTA
GGCCCTTGCGGCTGGGGATTGCGCTGGCTCGTGATGCAGACGCGCGCCGTTCAGGAGCGGTTCAACGAGGAAAGG
ATCAAGCTTGGGCTCGAGCCTAAGGAAATTGAAGATAAAGATCATATTATCGACTATGTACTAGATCGCGCTACT
CCAGGGCCTCTCAATGCGCGCAGTCGGGCTACGCTTGCCAGCTTGCGCGCCTCCATGGCCGACGCCGTCGTCTGC
GGTAACGACTCCGTGGTCAAACTGTCATGA
Transcript >Ophcf2|01829
ATGAGATATCCGGGAAACGTCTTTCGAACTTTATCCACCACCACGCCCTTATTCGCCAAAACTATCAAACCCACC
AAGCTCCCGCGGGACCTCGTGCCTGCTTACCCTTATGGCGAACGCCGCGTATACAAGCAGTCGAACCGTGGGCTC
TACGGACACGCCCGCGTCCGCTATGGCTACAATGTTTCCGAAAAGTGGTTTACCAAAAGCCAGCGGTTGTGGCGG
CCTAACATCCACGTCAAGATCCTCAAATCCAAAGCTCTCGGCGTACGCATAAGGCTCCGTCTTACGCTCCGCGTC
CTCAAGACGATCCTACGTGAGGGCGGTGTGGACAATTACCTTCTGGGGACAAAGCCAGGCCGGCTCCAAGACCTA
GGCCCTTGCGGCTGGGGATTGCGCTGGCTCGTGATGCAGACGCGCGCCGTTCAGGAGCGGTTCAACGAGGAAAGG
ATCAAGCTTGGGCTCGAGCCTAAGGAAATTGAAGATAAAGATCATATTATCGACTATGTACTAGATCGCGCTACT
CCAGGGCCTCTCAATGCGCGCAGTCGGGCTACGCTTGCCAGCTTGCGCGCCTCCATGGCCGACGCCGTCGTCTGC
GGTAACGACTCCGTGGTCAAACTGTCATGA
Gene >Ophcf2|01829
ATGAGATATCCGGGAAACGTCTTTCGAACTTTATCCACCACCACGCCCTTATTCGCCAAAACTATCAAACCCACC
AAGCTCCCGCGGGACCTCGTGCCTGCTTACCCTTATGGCGAACGCCGCGTATACAAGCAGTCGAACCGTGGGCTC
TACGGACACGCCCGCGTCCGCTATGGCTACAATGTTTCCGAAAAGTGGTTTACCAAAAGCCAGCGGTTGTGGCGG
CCTAACATCCACGTCAAGATCCTCAAATCCAAAGCTCTCGGCGTACGCATAAGGCTCCGTCTTACGCTCCGCGTC
CTCAAGACGATCCTACGTGAGGGCGGTGTGGACAATTACCTTCTGGGGACAAAGCCAGGCCGGCTCCAAGACCTA
GGCCCTTGCGGCTGGGGATTGCGCTGGCTCGTGATGCAGACGCGCGCCGTTCAGGAGCGGTTCAACGAGGAAAGG
ATCAAGCTTGGGCTCGAGCCTAAGGAAATTGAAGATAAAGATCATATTATCGACTATGTACTAGATCGCGCTACT
CCAGGGCCTCTCAATGCGCGCAGTCGGGCTACGCTTGCCAGCTTGCGCGCCTCCATGGCCGACGCCGTCGTCTGC
GGTAACGACTCCGTGGTCAAACTGTCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail