Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01822
Gene name
Locationscaffold_02:1665603..1668533
Strand+
Gene length (bp)2930
Transcript length (bp)927
Coding sequence length (bp)927
Protein length (aa) 309

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07819 PGAP1 PGAP1-like protein 1.7E-33 40 147

GO

GO Term Description Terminal node
GO:0016788 hydrolase activity, acting on ester bonds Yes
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

Domain # Start End Length
1 157 179 22
2 199 218 19
3 233 255 22
4 268 290 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01822
MSYMRPSYVHLTDFGNEHTRFATKYSLYLYREQGIDDEQLRGIPVLFIPGNAGSYKQVRPIAAEAASYHHNILLD
RRNSMQPGVRNLDFFTVDFNEDITAFHGQTLLDQAEYLNEAVRYILSLYSDPQRAGRDDEIPDPSAVVILVHRVV
LFLVSTVIPYQFAYVVACLVQMFTVICAFRTNTKLASVDSQNFYHYAHSILLLMMWVLPINLPILAVWARNLAVH
WLTPFPSHHNVFCIIPFMLLVENLTAGSMVPQMRSWHRHVTNLLLVGTAFCVALYGVSHAYALHYLVNAVAAWLV
YLHSTKHA*
Coding >Ophcf2|01822
ATGTCCTACATGAGGCCCTCCTACGTACACCTTACGGATTTCGGCAACGAGCACACCCGGTTCGCGACGAAGTAC
TCGCTATATCTCTACCGCGAGCAGGGAATCGATGACGAGCAGTTGCGTGGAATTCCGGTCCTTTTCATACCCGGA
AATGCTGGAAGCTACAAGCAAGTTCGACCGATAGCAGCCGAGGCTGCCAGTTATCATCATAATATCTTGCTGGAC
CGCCGCAACTCGATGCAGCCTGGAGTACGGAATCTCGACTTCTTCACGGTCGACTTCAACGAGGACATCACCGCT
TTCCACGGCCAAACACTTCTCGACCAAGCTGAGTATCTCAACGAGGCTGTCCGCTACATTCTTTCCCTGTACTCC
GATCCTCAACGAGCGGGCCGTGATGACGAGATTCCTGATCCTTCGGCTGTTGTCATACTCGTTCATCGTGTTGTG
CTCTTCCTGGTATCTACTGTTATCCCGTATCAGTTCGCCTACGTGGTGGCCTGTCTTGTTCAGATGTTCACCGTC
ATCTGCGCTTTTCGGACCAACACAAAGCTGGCCTCAGTCGACAGCCAGAACTTCTACCATTACGCTCACTCGATC
CTCCTCCTGATGATGTGGGTTCTCCCGATCAACCTACCAATTCTCGCTGTATGGGCGCGCAATCTCGCCGTCCAT
TGGCTCACACCTTTTCCCTCGCATCACAACGTCTTCTGCATTATTCCTTTCATGCTCTTGGTGGAAAACCTCACA
GCTGGCAGCATGGTTCCCCAGATGAGGAGCTGGCATCGCCACGTCACGAATCTTCTCCTGGTCGGGACCGCCTTC
TGCGTCGCTCTTTATGGCGTATCGCACGCATATGCCTTGCACTACCTCGTCAATGCGGTGGCTGCGTGGCTCGTC
TATCTCCACTCGACAAAACACGCCTGA
Transcript >Ophcf2|01822
ATGTCCTACATGAGGCCCTCCTACGTACACCTTACGGATTTCGGCAACGAGCACACCCGGTTCGCGACGAAGTAC
TCGCTATATCTCTACCGCGAGCAGGGAATCGATGACGAGCAGTTGCGTGGAATTCCGGTCCTTTTCATACCCGGA
AATGCTGGAAGCTACAAGCAAGTTCGACCGATAGCAGCCGAGGCTGCCAGTTATCATCATAATATCTTGCTGGAC
CGCCGCAACTCGATGCAGCCTGGAGTACGGAATCTCGACTTCTTCACGGTCGACTTCAACGAGGACATCACCGCT
TTCCACGGCCAAACACTTCTCGACCAAGCTGAGTATCTCAACGAGGCTGTCCGCTACATTCTTTCCCTGTACTCC
GATCCTCAACGAGCGGGCCGTGATGACGAGATTCCTGATCCTTCGGCTGTTGTCATACTCGTTCATCGTGTTGTG
CTCTTCCTGGTATCTACTGTTATCCCGTATCAGTTCGCCTACGTGGTGGCCTGTCTTGTTCAGATGTTCACCGTC
ATCTGCGCTTTTCGGACCAACACAAAGCTGGCCTCAGTCGACAGCCAGAACTTCTACCATTACGCTCACTCGATC
CTCCTCCTGATGATGTGGGTTCTCCCGATCAACCTACCAATTCTCGCTGTATGGGCGCGCAATCTCGCCGTCCAT
TGGCTCACACCTTTTCCCTCGCATCACAACGTCTTCTGCATTATTCCTTTCATGCTCTTGGTGGAAAACCTCACA
GCTGGCAGCATGGTTCCCCAGATGAGGAGCTGGCATCGCCACGTCACGAATCTTCTCCTGGTCGGGACCGCCTTC
TGCGTCGCTCTTTATGGCGTATCGCACGCATATGCCTTGCACTACCTCGTCAATGCGGTGGCTGCGTGGCTCGTC
TATCTCCACTCGACAAAACACGCCTGA
Gene >Ophcf2|01822
ATGTCCTACATGAGGCCCTCCTACGTACACCTTACGGATTTCGGCAACGAGCACACCCGGTTCGCGACGAAGTAC
TCGCTATATCTCTACCGCGAGCAGGGAATCGATGACGAGCAGGTGTGTAATGCAGAGGCTTAATTTTCCCCGTCA
GCGGGGATCACAGGGCTCTATCTTATGACCTCATCGGGCAGTTGCGTGGAATTCCGGTCCTTTTCATACCCGGAA
ATGCTGGAAGCTACAAGCAAGTTCGACCGATAGCAGCCGAGGCTGCCAGTTATCATCATAATATCTTGCTGGACC
GCCGCAACTCGATGCAGCCTGGAGTACGGAATCTCGACTTCTTCACGGTCGACTTCAACGAGGACATCACCGCTT
TCCACGGCCAAACACTTCTCGACCAAGCTGAGTATCTCAACGAGGCTGTCCGCTACATTCTTTCCCTGTACTCCG
ATCCTCAACGAGCGGGCCGTGATGACGAGATTCCTGATCCTTCGGCTGTTGTCATACTCGGTCATTCCATGGGTG
GTGTTGTGGCCCGTGCAATGTTGACGCAGCCCAATTATCAGTCCAAGTCCATCAATTCAATCATAACCATGGCTG
CGCCACACGCTCGTCCGCCAGTCACATTCGATGCTCAAATTGTACATATCTATGACGAGATTAACGGGTACTGGC
GACGCGCCTATGCGCAGAAATGGGCAAATGACAACCCATTGTGGCATGTCACCCTTGTGTCCATTGCTGGTGGTA
GCCTCGACACTGTCGTGCCATCAGACTACGCTAGCCTCGAATCTATCGTACCCGAAACCCACGGCTTTACCGTCT
TCACTTCCGGAATACCGAATGTCTGGACGAGTATGGATCACCAAGCCATTCTCTGGTGTGATCAATTTCGGAAAG
TGGTTGCTCGAGCGCTTTACGATATAGTTGACGCCACTCGAGCATCTCAGACGAAGCCCAGGGCCGATAGGATGC
GACTCTTGAAGCGACGATTTCTTCCAGGCATGGAAATTGACGCAGAGAAGGTAGCAACTTTTCGGCATGGTTCAA
TACCACTCAGCACAACTGATGACTCAAGCAAATTCGTGTTAGCTGGACCGAGGCTTTCTCTCGGCACCCAGACTG
AGGAATTCACACCCACATCTTACTTAATTCCTGTCCCGCCCCCGGACCTCCTCGGCACCAAGCGCTTTACTTTCA
TCACTGACGCTTCATTGGATCTGAATGCTGCGAAGGCTGGCCTCCAGGTGCTCTTGTGCAGCGTTATCCCCAATG
CCCTGGACTCGGACGGCGTCCGGTCCCCAAGGCATTTGGGCTTGGCGGCGGGACGCACATCGTTCGAAAGCCTTT
CCTGCAAAAGCTCCGCGCCGGACGCCATCTTCTTGCCTGCGCAGTCCCGCCCTGCTGATGCTGGAGATGCACAAT
CACAGGCCCAGCCTTATACATATCTGCATTACGGACCTGAACACCTTACAGACCACCAGTTCATCGTGGTCAGAG
TATTGTCAGAGCTATCTGCATTTGTCCTTGCCGAGTTCAGTGATGCGCAAGACTTCCAAATCAAGCACAATGCGA
CTCTTGCTCAGCTTCTTACTGAGGGTCTTGTCTTTGACTTACAGCCTGACCGGCCTCTCGTGGTCGACGTCAGCA
TAATGTCCGCTGCTTCGGCTTTGCTAGCCTTCAAGCTTGAAATCAGTAATTCACGGTGTTCTGGAAAACGGAAAA
TGCCTACGCTGATAAGGCAATTTTTGAACAAGCCTTATGAGTCCAAGTATTTCATCAATACTAGGCAAGTCAGTG
TCAGCCTCCATGGAAAAGCTCCCTTTCTCCCGCCGCCCCTGGAAACAGCAAGAGAAGTCGGCCTCACACTTCAGA
TCTGGTCCGATCCGATCTGCGAGTCGCCGCTCACAGCGCGGCTGAGGCTTGATGTTTGGGCCAGCTTTGGCAAAC
TGTACATGCGCTATCGAACCATTATCGCTGCGTTTCCTCTGCTCGTGGAGGCTATGGTGCTCCGAAAGCAGATTC
GTGTATATGATGAGGCGGGCATTTTCATGTCCTTTTCTCAAGGCCTGGACCAGTCCCTTCGGAGATCCATCCCCC
TTTTACTTGCTTGCCTTACACTGCTGTCCTCCTTGTTCGGTTCATTTACGAGACAGGAGGGTGCCAGCCAGTCAT
TGTCTAAGGATCGCGGATTTCACCGAAACGAGCTGCTCTTGGGAACCGAGGACTTTCTCTTTTGCCTACTGATAC
CCCTCATCGGTATGGTCTGCGTTGGGGTGTGCACAATTCTCCATTGTATCATGGTCTGTTTCACACGAGCACTGG
GCCTGTTGTTTGGCTCCATCAGCCGTGGCTCGCTGAGCAAAGCAAGGGCTATCCGGCAACCTCGACCGTTTCCAA
TCAGCCTTCTATTTTTCACATCGCCGAGAAGGATGCTTTTCAGCGCAGTTGTGCTCTTCCTGGTATCTACTGTTA
TCCCGTATCAGTTCGCCTACGTGGTGGCCTGTCTTGTTCAGATGTTCACCGTCATCTGCGCTTTTCGGACCAACA
CAAAGCTGGCCTCAGTCGACAGCCAGAACTTCTACCATTACGCTCACTCGATCCTCCTCCTGATGATGTGGGTTC
TCCCGATCAACCTACCAATTCTCGCTGTATGGGCGCGCAATCTCGCCGTCCATTGGCTCACACCTTTTCCCTCGC
ATCACAACGTCTTCTGCATTATTCCTTTCATGCTCTTGGTGGAAAACCTCACAGCTGGCAGCATGGTTCCCCAGA
TGAGGAGCTGGCATCGCCACGTCACGAATCTTCTCCTGGTCGGGACCGCCTTCTGCGTCGCTCTTTATGGCGTAT
CGCACGCATATGCCTTGCACTACCTCGTCAATGCGGTGGCTGCGTGGCTCGTCTATCTCCACTCGACAAAACACG
CCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail