Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01816
Gene name
Locationscaffold_02:1425628..1426156
Strand+
Gene length (bp)528
Transcript length (bp)357
Coding sequence length (bp)357
Protein length (aa) 119

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02991 ATG8 Autophagy protein Atg8 ubiquitin like 3.6E-51 13 116
PF04110 APG12 Ubiquitin-like autophagy protein Apg12 5.7E-06 39 116

GO

GO Term Description Terminal node
GO:0005737 cytoplasm Yes
GO:0000045 autophagosome assembly Yes
GO:0005575 cellular_component No
GO:0071840 cellular component organization or biogenesis No
GO:1905037 autophagosome organization No
GO:0008150 biological_process No
GO:0007033 vacuole organization No
GO:0006996 organelle organization No
GO:0009987 cellular process No
GO:0022607 cellular component assembly No
GO:0070925 organelle assembly No
GO:0016043 cellular component organization No
GO:0110165 cellular anatomical entity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Signal peptide 0.5302 0.3445 0.2646 0.3233 0.0708 0.0004 0.2255 0.5263 0.3069 0.0029

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2138
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2543
Ophiocordyceps australis map64 (Brazil) OphauB2|6723
Ophiocordyceps camponoti-floridani Ophcf2|01816 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4900
Ophiocordyceps kimflemingae Ophio5|1130
Ophiocordyceps subramaniannii Hirsu2|2569

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01816
MRSKFKDEHPFEKRKAEAERIRQKYADRIPVICEKVEKSDITTIDKKKYLVPSDLTVGQFVYVIRKRIKLSPEKA
IFIFVDEVLPPTAALMSSIYEEHKDEDGFLYITYSGENTFGCA*
Coding >Ophcf2|01816
ATGCGGAGCAAATTCAAAGACGAACATCCCTTCGAGAAGCGCAAGGCGGAGGCCGAACGTATCCGGCAGAAGTAC
GCCGACAGAATCCCCGTGATCTGCGAAAAGGTCGAGAAGAGCGACATCACCACCATTGACAAAAAAAAGTACCTT
GTCCCATCCGATCTCACTGTGGGCCAGTTTGTCTATGTCATTCGGAAAAGAATCAAGTTGTCGCCAGAAAAGGCC
ATTTTCATCTTCGTGGATGAGGTCCTACCTCCCACTGCTGCTCTTATGAGCAGCATCTACGAAGAGCACAAAGAT
GAAGACGGGTTTCTGTATATCACCTATTCGGGCGAGAATACTTTCGGCTGTGCTTGA
Transcript >Ophcf2|01816
ATGCGGAGCAAATTCAAAGACGAACATCCCTTCGAGAAGCGCAAGGCGGAGGCCGAACGTATCCGGCAGAAGTAC
GCCGACAGAATCCCCGTGATCTGCGAAAAGGTCGAGAAGAGCGACATCACCACCATTGACAAAAAAAAGTACCTT
GTCCCATCCGATCTCACTGTGGGCCAGTTTGTCTATGTCATTCGGAAAAGAATCAAGTTGTCGCCAGAAAAGGCC
ATTTTCATCTTCGTGGATGAGGTCCTACCTCCCACTGCTGCTCTTATGAGCAGCATCTACGAAGAGCACAAAGAT
GAAGACGGGTTTCTGTATATCACCTATTCGGGCGAGAATACTTTCGGCTGTGCTTGA
Gene >Ophcf2|01816
ATGCGGAGCAAATTCAAAGACGAACATCCCTTCGAGAAGCGCAAGGCGGAGGCCGAACGTATCCGGCAGAAGTAC
GCCGACAGAATCCCCGTCAGTATTCCCCGACAAGTGGCGCCTCCGCGATCCAGCCCTATCTTCCATCTCCAAATA
TACAGTCATATCTGTGCTGTTGGTGAGTTGGAAAGCTTATTATGTCTTCTAGGTGATCTGCGAAAAGGTCGAGAA
GAGCGACATCACCACCATTGACAAAAAAAAGTACCTTGTCCCATCCGATCTCACTGTGGGCCAGTTTGTCTATGT
CATTCGGAAAAGAATCAAGTTGTCGCCAGAAAAGGCCATTTTCATCTTCGTGGATGAGGTCCTACCTCCCACTGC
TGCTCTTATGAGCAGCATCTACGAAGAGCACAAAGATGAAGACGGGTAAGGTTCCTCGAGCCCATCCGCAACTGT
TTTCTTGTGCCGACGCATGATGGATGCAGGTTTCTGTATATCACCTATTCGGGCGAGAATACTTTCGGCTGTGCT
TGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail