Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01812
Gene name
Locationscaffold_02:1204886..1205761
Strand-
Gene length (bp)875
Transcript length (bp)612
Coding sequence length (bp)612
Protein length (aa) 204

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08569 Mo25 Mo25-like 9.1E-40 3 166

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal|Nuclear export signal 0.4823 0.5853 0.1078 0.1576 0.212 0.0192 0.1823 0.3303 0.5109 0.0579

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5155
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|381
Ophiocordyceps australis map64 (Brazil) OphauB2|8167
Ophiocordyceps camponoti-floridani Ophcf2|01812 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4893
Ophiocordyceps kimflemingae Ophio5|1024
Ophiocordyceps subramaniannii Hirsu2|3627

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01812
MSFLFGRARGRAAADLPKQAHDHITKLDGPNGASKAEELARVLNQMKLILQGTNEADNSPEQIYQLVTGLIEEDL
LYLLATNLHRLPFESRKDAQVIFSYIFRFRTTVSTTNSDPIALSYVVNSRPQVVIELCRAYDHKESATPAGSVLR
EILKNEAAASIILHDDGDEPGSSARGIKSIDPHSRLPLTLSPPFETFLPVTRI*
Coding >Ophcf2|01812
ATGTCATTCCTGTTTGGTCGAGCTCGCGGACGAGCGGCTGCCGACTTGCCAAAGCAAGCGCATGATCATATCACA
AAGCTTGACGGCCCTAATGGAGCATCGAAGGCAGAAGAGCTTGCCCGCGTCCTGAACCAAATGAAGTTGATTTTG
CAGGGTACTAATGAAGCCGACAACTCTCCCGAACAAATATATCAACTAGTTACAGGCCTTATTGAGGAGGACTTA
TTGTATCTTCTTGCCACCAATCTCCACCGCTTACCTTTTGAGTCCCGCAAGGACGCTCAAGTCATATTCTCCTAC
ATATTTAGGTTTCGGACTACTGTTTCGACCACCAACAGCGATCCAATAGCTCTCTCATACGTTGTAAACAGTCGA
CCTCAAGTGGTTATAGAACTGTGCCGGGCCTACGATCATAAGGAAAGTGCCACACCAGCCGGTTCAGTACTTCGC
GAGATATTGAAGAACGAGGCGGCCGCGTCTATTATTCTTCACGATGACGGAGATGAACCTGGGTCTAGCGCTAGA
GGCATCAAATCTATTGACCCTCATTCGAGGTTGCCGCTGACGCTTTCACCACCTTTCGAGACCTTCTTACCCGTC
ACAAGGATCTAG
Transcript >Ophcf2|01812
ATGTCATTCCTGTTTGGTCGAGCTCGCGGACGAGCGGCTGCCGACTTGCCAAAGCAAGCGCATGATCATATCACA
AAGCTTGACGGCCCTAATGGAGCATCGAAGGCAGAAGAGCTTGCCCGCGTCCTGAACCAAATGAAGTTGATTTTG
CAGGGTACTAATGAAGCCGACAACTCTCCCGAACAAATATATCAACTAGTTACAGGCCTTATTGAGGAGGACTTA
TTGTATCTTCTTGCCACCAATCTCCACCGCTTACCTTTTGAGTCCCGCAAGGACGCTCAAGTCATATTCTCCTAC
ATATTTAGGTTTCGGACTACTGTTTCGACCACCAACAGCGATCCAATAGCTCTCTCATACGTTGTAAACAGTCGA
CCTCAAGTGGTTATAGAACTGTGCCGGGCCTACGATCATAAGGAAAGTGCCACACCAGCCGGTTCAGTACTTCGC
GAGATATTGAAGAACGAGGCGGCCGCGTCTATTATTCTTCACGATGACGGAGATGAACCTGGGTCTAGCGCTAGA
GGCATCAAATCTATTGACCCTCATTCGAGGTTGCCGCTGACGCTTTCACCACCTTTCGAGACCTTCTTACCCGTC
ACAAGGATCTAG
Gene >Ophcf2|01812
ATGTCATTCCTGTTTGGTCGAGCTCGCGGACGAGCGGCTGCCGACTTGCCAAAGCAAGCGCATGATCATATCACA
AAGCTTGACGGCCCTAATGGAGCATCGAAGGTGTCACTGCCGCTGCAACTTTAGTCCCGGTCACTGACTGGCTCT
TTAGGCAGAAGAGCTTGCCCGCGTCCTGAACCAAATGAAGTTGATTTTGCAGGGTACTAATGGTCTGTTCACATG
TACAACGCAAATCATTTGTTTAACTCATGATCGCATGTGACCTCACTCACACTCTCTTAATTAGAAGCCGACAAC
TCTCCCGAACAAATATATCAACTAGTTACAGGCCTTATTGAGGAGGACTTATTGTATCTTCTTGCCACCAATCTC
CACCGCTTACCTTTTGAGTCCCGCAAGGACGCTCAAGTCATATTCTCCTACATATTTAGGTTTCGGACTACTGTT
TCGACCACCAACAGCGATCCAATAGCTCTCTCATACGTTGTAAACAGTCGACCTCAAGTGGTTATAGAACTGTGC
CGGGCCTACGATCATAAGGAAAGTGCCACACCAGCCGGTTCAGTACTTCGCGAGATATTGAAGAACGAGGCGGCC
GCGTCTATTATTCTTCACGATGACGGAGATGAACCTGGGTCTAGCGCTAGAGGCATCAAATCTATTGACCGTGAG
AGATGTCAAACAGGCAGAGGCGTGTTTTGGAAGTTTTTTGAATGGATCGACAAGAGCTCATTCGAGGTTGCCGCT
GACGCTTTCACCACCTTTCGAGCAAGTTAAATATCCCTTCACACCGTAGGAAACTGAATTCGAAAACACAGAGCT
AACATCAAATTTGTCTTCTAAGGACCTTCTTACCCGTCACAAGGATCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail