Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01811
Gene name
Locationscaffold_02:1184095..1185795
Strand-
Gene length (bp)1700
Transcript length (bp)1146
Coding sequence length (bp)1146
Protein length (aa) 382

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13649 Methyltransf_25 Methyltransferase domain 2.7E-11 137 234
PF06325 PrmA Ribosomal protein L11 methyltransferase (PrmA) 7.2E-11 133 209
PF08241 Methyltransf_11 Methyltransferase domain 5.0E-10 138 237
PF13847 Methyltransf_31 Methyltransferase domain 1.1E-08 134 249
PF13489 Methyltransf_23 Methyltransferase domain 1.2E-06 131 239
PF05175 MTS Methyltransferase small domain 3.9E-06 134 206

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016740 transferase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal|Nuclear export signal 0.7395 0.5439 0.026 0.0585 0.1591 0.0111 0.0827 0.1117 0.2031 0.0082

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6076
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6284
Ophiocordyceps australis map64 (Brazil) OphauB2|8172
Ophiocordyceps camponoti-floridani Ophcf2|01811 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5492
Ophiocordyceps subramaniannii Hirsu2|2851

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01811
MPLVISLFDSKTFATLDDMLCHCQEHCGFDLVAIIQRLSLDYIGAVKLVNFDCLANFRLSVEETLNKRWGNEEDV
SDVALDLRSQHRLPAGESFPERYFETYASNEIHEIMLKDQIRTDAYRDFIYGNKHLFAGKVVLDVGCGTGILSML
CAKAGASRVLAVDKSDIIDKARENVFNNGLSKAITCLRGSIEDVVLPVDKVDIIVSEWMGYCLLYEAMLSSVLYA
RDKYLKPEGLLVPSSATLWIAPVEDQAYVDESVTYWQDVYGFDMRAMQEAIFNEVRVEAMTQASLCGDSFPFKVL
DLRSARIEDLEFAARWSSTLNRTVDRIDGFLIWFDIFFSPSPETPPPDLYVTPTEWCSKSRNYGFTTGPLGQEMN
QSWDLR*
Coding >Ophcf2|01811
ATGCCTTTAGTCATATCGTTGTTCGACTCGAAGACTTTTGCGACGTTGGACGACATGCTTTGTCACTGTCAGGAG
CATTGTGGGTTCGACTTGGTAGCGATTATTCAAAGACTGAGCCTGGATTACATCGGTGCCGTCAAGCTTGTCAAC
TTTGACTGCTTGGCCAACTTTCGCCTCAGTGTGGAGGAAACTTTAAACAAACGCTGGGGAAACGAGGAAGACGTC
TCAGACGTGGCCCTTGACCTGAGATCTCAACATCGATTGCCCGCCGGAGAGTCCTTCCCTGAACGATATTTTGAA
ACCTACGCCTCAAATGAAATACACGAAATCATGCTCAAGGACCAAATTCGTACCGACGCATACAGAGACTTCATC
TACGGAAATAAGCACCTATTTGCTGGCAAGGTCGTCCTAGATGTTGGCTGCGGCACTGGTATTCTAAGCATGCTC
TGTGCCAAGGCCGGGGCCAGCCGGGTCCTAGCTGTGGACAAGTCGGACATCATTGACAAAGCTAGAGAAAATGTC
TTCAATAACGGACTATCCAAGGCCATAACATGCCTGAGAGGATCCATCGAGGACGTGGTGTTACCGGTCGATAAG
GTAGACATAATTGTCAGCGAATGGATGGGGTATTGCTTGCTCTACGAAGCCATGCTATCCAGCGTGCTGTACGCA
CGAGATAAATACTTGAAGCCCGAGGGCCTGCTCGTGCCAAGCTCGGCTACTTTGTGGATAGCTCCTGTCGAGGAC
CAGGCCTACGTGGATGAAAGCGTCACATACTGGCAAGACGTCTACGGTTTCGATATGCGGGCCATGCAGGAGGCC
ATATTCAACGAGGTCCGCGTAGAGGCCATGACACAGGCTTCTCTTTGCGGTGACAGTTTCCCCTTCAAAGTCCTT
GACCTTCGGTCTGCAAGAATTGAGGACTTGGAGTTCGCAGCTCGTTGGAGCTCGACGCTGAATCGGACCGTGGAC
AGGATTGATGGATTCCTTATCTGGTTCGACATCTTTTTCTCACCATCCCCTGAGACGCCTCCCCCTGATCTATAT
GTCACACCGACCGAGTGGTGCAGCAAGTCCAGGAACTATGGCTTCACCACGGGACCCCTTGGTCAGGAGATGAAT
CAGTCGTGGGACCTCAGATGA
Transcript >Ophcf2|01811
ATGCCTTTAGTCATATCGTTGTTCGACTCGAAGACTTTTGCGACGTTGGACGACATGCTTTGTCACTGTCAGGAG
CATTGTGGGTTCGACTTGGTAGCGATTATTCAAAGACTGAGCCTGGATTACATCGGTGCCGTCAAGCTTGTCAAC
TTTGACTGCTTGGCCAACTTTCGCCTCAGTGTGGAGGAAACTTTAAACAAACGCTGGGGAAACGAGGAAGACGTC
TCAGACGTGGCCCTTGACCTGAGATCTCAACATCGATTGCCCGCCGGAGAGTCCTTCCCTGAACGATATTTTGAA
ACCTACGCCTCAAATGAAATACACGAAATCATGCTCAAGGACCAAATTCGTACCGACGCATACAGAGACTTCATC
TACGGAAATAAGCACCTATTTGCTGGCAAGGTCGTCCTAGATGTTGGCTGCGGCACTGGTATTCTAAGCATGCTC
TGTGCCAAGGCCGGGGCCAGCCGGGTCCTAGCTGTGGACAAGTCGGACATCATTGACAAAGCTAGAGAAAATGTC
TTCAATAACGGACTATCCAAGGCCATAACATGCCTGAGAGGATCCATCGAGGACGTGGTGTTACCGGTCGATAAG
GTAGACATAATTGTCAGCGAATGGATGGGGTATTGCTTGCTCTACGAAGCCATGCTATCCAGCGTGCTGTACGCA
CGAGATAAATACTTGAAGCCCGAGGGCCTGCTCGTGCCAAGCTCGGCTACTTTGTGGATAGCTCCTGTCGAGGAC
CAGGCCTACGTGGATGAAAGCGTCACATACTGGCAAGACGTCTACGGTTTCGATATGCGGGCCATGCAGGAGGCC
ATATTCAACGAGGTCCGCGTAGAGGCCATGACACAGGCTTCTCTTTGCGGTGACAGTTTCCCCTTCAAAGTCCTT
GACCTTCGGTCTGCAAGAATTGAGGACTTGGAGTTCGCAGCTCGTTGGAGCTCGACGCTGAATCGGACCGTGGAC
AGGATTGATGGATTCCTTATCTGGTTCGACATCTTTTTCTCACCATCCCCTGAGACGCCTCCCCCTGATCTATAT
GTCACACCGACCGAGTGGTGCAGCAAGTCCAGGAACTATGGCTTCACCACGGGACCCCTTGGTCAGGAGATGAAT
CAGTCGTGGGACCTCAGATGA
Gene >Ophcf2|01811
ATGCCTTTAGTCATATCGTTGTTCGACTCGAAGACTTTTGCGACGTTGGACGACATGCTTTGTCACTGTCAGGAG
CATTGTGGGTTCGACTTGGTAGCGATTATTCAAAGACTGAGCCTGGATTACATCGGTGCCGTCAAGCTTGTCAAC
TTTGTTCGTCTTCGCGTGCAGCAAGGACGAGCTCTACCCGACGTAATCTACCTAAGTCACATAGATGATGACATG
TTTCTCAAACCTGTCTTGCACGACGATGCAGTTCTCTACTCTCTGGACGACATTATGAACAACTCAGGAGAGACA
CATGAAGTCTCTGATGAAGAGACAAGGATATTACTTGACCGCAATAGACAGCTAGAAGCGGAGTTGAAACATACA
CAGGACTGCTTGGCCAACTTTCGCCTCAGTGTGGAGGAAACTTTAAACAAACGCTGGGGAAACGAGGAAGACGTC
TCAGACGTGGCCCTTGACCTGAGATCTCAACATCGATTGCCCGCCGGAGAGTCCTTCCCTGAACGATATTTTGAA
ACCTACGCCTCAAATGGTATGTTCTTGATCACTTTGTTCCGGACCGACTGCAACTGAGGACACAAGAAATACACG
AAATCATGCTCAAGGACCAAATTCGTACCGACGCATACAGAGACTTCATCTACGGAAATAAGCACCTATTTGCTG
GCAAGGTCGTCCTAGATGTTGGCTGCGGCACTGGTGAGGTTGTCTCATTTCATTGAAGCTGCTATTGTCATCCAA
TTTTGATCCCTGCCCCAAGCTCTCTCAAATTTGTTTTTGCTGAATCTTGTGATATTAACACTATTTCACATATCT
CAGGTATTCTAAGCATGCTCTGTGCCAAGGCCGGGGCCAGCCGGGTCCTAGCTGTGGACAAGTCGGACATCATTG
ACAAAGCTAGAGAAAATGTCTTCAATAACGGACTATCCAAGGCCATAACATGCCTGAGAGGATCCATCGAGGACG
TGGTGTTACCGGTCGATAAGGTAGACATAATTGTCAGCGAATGGATGGGGTATTGCTTGCTCTACGAAGCCATGC
TATCCAGCGTGCTGTACGCACGAGATAAATACTTGAAGCCCGAGGGCCTGCTCGTGCCAAGCTCGGCTACTTTGT
GGATAGCTCCTGTCGAGGACCAGGCCTACGTGGATGAAAGCGTCACATACTGGCAAGACGTCTACGGTTTCGATA
TGCGGGCCATGCAGGAGGCCATATTCAACGAGGTCCGCGTAGAGGCCATGACACAGGCTTCTCTTTGCGGTGACA
GTTTCCCCTTCAAAGTCCTTGACCTTCGGTCTGCAAGAATTGAGGACTTGGAGTTCGCAGCTCGTTGGAGCTCGA
CGCTGAATCGGACCGTGGACAGGATTGATGGATTCCTTATCTGGTTCGACATCTTTTTCTCACCATCCCCTGAGA
CGCCTCCCCCTGATCTATATGTCACACCGACCGAGTGGTGCAGCAAGTCCAGGAACTATGGCTTCACCACGGGAC
CCCTTGGTAAACAGACGCATTGGAAACAAGGCTTGATGCTTATTGCTCAACCGGACTCACCATTGAAACTATCCA
CACAACACACTGTCAGTGGGACAATCTCATTCTCGGTTCCTCAGCATAGTCGTCGTGCTTTGAAACTCGAAAACT
CGTGGTTCGTCTCAGGTCAGGAGATGAATCAGTCGTGGGACCTCAGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail