Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01810
Gene name
Locationscaffold_02:1181575..1183996
Strand+
Gene length (bp)2421
Transcript length (bp)834
Coding sequence length (bp)834
Protein length (aa) 278

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03169 OPT OPT oligopeptide transporter protein 1.1E-07 4 64
PF03169 OPT OPT oligopeptide transporter protein 4.2E-35 64 179
PF03169 OPT OPT oligopeptide transporter protein 2.6E-13 178 269

GO

GO Term Description Terminal node
GO:0035673 oligopeptide transmembrane transporter activity Yes
GO:1904680 peptide transmembrane transporter activity No
GO:0042887 amide transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 2 21 19
2 36 54 18
3 102 121 19
4 141 163 22
5 176 198 22
6 213 235 22
7 248 270 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01810
MGIMPLGCGFVGVIPAMNYLLTSDERGPLSLRLDQLIVWSLGLCYFGVVFAVPLRHQVIVRERLSIMGVRALGET
DLNPVSGISKLAQLLFALIIPQSDKSSVLINLVAGAVSEAGALQAGDLMQDLKTGHLLGASPRAQFYGQMIGATF
GAILSAVLYGLYTKVYAIPGHGLPPMASQWATGAGALFTLTTMFRIATVGKAWRSWVPGGIAVAVGIYNVPSFTF
GRAIGGLLSWYWTRRLQRSGTPLIIVASGFVLGEGFLSIVTLILQSFGVPHF*
Coding >Ophcf2|01810
ATGGGCATTATGCCACTCGGCTGTGGATTTGTTGGTGTCATCCCGGCCATGAATTACTTATTGACATCCGATGAA
CGGGGGCCCCTTTCCTTACGTCTTGACCAACTCATTGTCTGGTCGCTGGGGCTTTGCTATTTCGGTGTCGTATTT
GCCGTTCCTCTGCGCCACCAGGTTATTGTTCGTGAGCGCTTAAGCATCATGGGCGTCAGGGCTCTTGGCGAGACG
GACTTGAATCCTGTTTCTGGAATAAGCAAACTCGCTCAGCTGCTATTTGCCCTTATCATTCCCCAGTCCGACAAA
TCAAGCGTTCTTATCAATCTCGTTGCTGGCGCTGTCTCCGAAGCTGGGGCATTGCAGGCTGGCGATCTGATGCAG
GATCTCAAAACGGGTCACCTCCTTGGAGCTTCACCAAGGGCACAATTTTACGGTCAGATGATTGGCGCCACATTT
GGCGCAATTCTGAGCGCAGTCCTCTATGGACTTTACACAAAGGTTTACGCAATCCCGGGCCATGGACTGCCGCCA
ATGGCCAGCCAGTGGGCGACTGGCGCAGGAGCTCTCTTCACTCTCACAACAATGTTCAGGATCGCCACGGTGGGA
AAAGCCTGGCGATCCTGGGTCCCAGGGGGGATTGCGGTCGCCGTCGGCATATACAATGTTCCGTCCTTTACCTTT
GGCCGGGCTATAGGAGGTCTACTCAGCTGGTATTGGACGCGAAGATTGCAACGATCCGGAACTCCTCTAATTATT
GTTGCTTCTGGTTTCGTTCTGGGCGAGGGGTTTCTCAGCATTGTCACGTTAATTTTGCAGAGTTTTGGCGTGCCA
CATTTTTAG
Transcript >Ophcf2|01810
ATGGGCATTATGCCACTCGGCTGTGGATTTGTTGGTGTCATCCCGGCCATGAATTACTTATTGACATCCGATGAA
CGGGGGCCCCTTTCCTTACGTCTTGACCAACTCATTGTCTGGTCGCTGGGGCTTTGCTATTTCGGTGTCGTATTT
GCCGTTCCTCTGCGCCACCAGGTTATTGTTCGTGAGCGCTTAAGCATCATGGGCGTCAGGGCTCTTGGCGAGACG
GACTTGAATCCTGTTTCTGGAATAAGCAAACTCGCTCAGCTGCTATTTGCCCTTATCATTCCCCAGTCCGACAAA
TCAAGCGTTCTTATCAATCTCGTTGCTGGCGCTGTCTCCGAAGCTGGGGCATTGCAGGCTGGCGATCTGATGCAG
GATCTCAAAACGGGTCACCTCCTTGGAGCTTCACCAAGGGCACAATTTTACGGTCAGATGATTGGCGCCACATTT
GGCGCAATTCTGAGCGCAGTCCTCTATGGACTTTACACAAAGGTTTACGCAATCCCGGGCCATGGACTGCCGCCA
ATGGCCAGCCAGTGGGCGACTGGCGCAGGAGCTCTCTTCACTCTCACAACAATGTTCAGGATCGCCACGGTGGGA
AAAGCCTGGCGATCCTGGGTCCCAGGGGGGATTGCGGTCGCCGTCGGCATATACAATGTTCCGTCCTTTACCTTT
GGCCGGGCTATAGGAGGTCTACTCAGCTGGTATTGGACGCGAAGATTGCAACGATCCGGAACTCCTCTAATTATT
GTTGCTTCTGGTTTCGTTCTGGGCGAGGGGTTTCTCAGCATTGTCACGTTAATTTTGCAGAGTTTTGGCGTGCCA
CATTTTTAG
Gene >Ophcf2|01810
ATGGGCATTATGCCACTCGGCTGTGGATTTGTTGGTGTCGTCAGCTCAACCCCTTCTTCACTTAAGCGCGTTTAT
TGCTGCAGCCCAGGCTCACAACACTTTTCACAGATCCCGGCCATGAATTACTTATTGACATCCGATGAACGGGGG
CCCCTTTCCTTACGTCTTGACCAACTCATTGTCTGGTCGCTGGGGCTTTGCTATTTCGGTGTCGTATTTGCCGTT
CCTCTGTAAGATCTTCCTCTTCTGTGCTCACGGCCATACCATGAGCCCCGCATCCATTATAACCTTGAAAACCGG
CTGATGCCAGGCGTCATTATGACCGGGAAATAGGCGCCACCAGGTTATTGTTCGTGAGCGCTTAAGGTTCCCGAG
TGGTTTCAGCACGGCGGTTCTCATCGCCGTCTTGCATGGCCAATGGCAACCCTCTGCCGAACAGGAAGATCTCGA
TGCGACTGCCAGGGGAGGCTTTGCTAGTTTGATGTCGCGCAGTGAATACCATCCGCACTTAACAGAAACCACGAG
TTCCGAATCTGCATCGGCTGAGGAGATGGAGGTAGACCGCCAGGGGCCAGAAGCGCGACTTGACACAGAGTCGGA
GGCGCAAACGTCGGGTTTATCAAAATGGGACGATAACCTTAGGCTACTAATGTTTTCGTTTCTGGCGTCCGGCGC
ATTCACAATATGCACTTATTTTTTCCCCGTTCTGAGGAATATCCCGATACTTGGTTTTGGCGCGGCTAGTCAATG
GCTCTGGACGCTGAATCCAAGTTTGGCCTACATAGGTCAAGGCATGATAATGGGGGCTGAAACGACGATGCACAT
GACAGTCGGCGCTATCGTCGGTTGGGGTATCTTGAGCCCTTTAGCGAAATATAACGGCTGGGCTCCGGGTGCCGT
GGATGACTGGCAACAAGGAAGTAGGGGTTGGATTGTCTGGATTTCGCTCGCCATTATGCTTTCCGACGCCATTGT
TAGCCTTGGCTACATCGCTCTGCGTCCCGTTCTGGACAGGCTACTGATCAACCAACACGGGACCGCAATGCAGCG
ACTCCGTGGGTTATTGGACGTATTTGGACACCGCGTCGCCTATCAGCCTCTTTCAAGCAACGAGCAGGAACAATG
CTCAGTGTCAGCTTCAAACACTATTGACACTCAGGGCCGGAATGATCAGGCTGAAGATGCGCCTGCAGACCAGCG
CATCGGTGCACGCATCGTGGGTGTTGGCCTTGTCGCGTCCATCTTTCTATGTATAGGCACGGTACGCGCTGTGTT
TGGCAATATCGTCCCGGTCTATGCGACTATCGTCGCTGTCCTGATGGCACTTGTCCTCAGCATCATGGGCGTCAG
GGCTCTTGGCGAGACGGACTTGAATCCTGTTTCTGGAATAAGCAAACTCGCTCAGCTGCTATTTGCCCTTATCAT
TCCCCAGTCCGACAAATCAAGCGTTCTTATCAATCTCGTTGCTGGCGCTGTCGTACGTATTCTATCCGCCGCAAA
GGCTCTTGCTCTAGTTCAACATCGCCCCTGGCATGTTGGGAGTGGCATTTACTCCTCGTTCCCTCCGTAAGACGA
GCGCCGCTGACTAGGCCCCCTGCAGTCCGAAGCTGTGAGCCATATTGAAGCCCGAATGACATGAGTGCTGATGCT
GACATTGTGGTCTAGGGGGCATTGCAGGCTGGCGATCTGATGCAGGATCTCAAAACGGGTCACCTCCTTGGAGCT
TCACCAAGGGCACAATTTTACGGTCAGATGATTGGCGCCACATTTGGCGCAATTCTGAGCGCAGTCCTCTATGGA
CTTTACACAAAGTAGGTCTGAGCTCACATCAATGGACATGTCCTTGTGTATGTCATCGATGTTTCCTCCCGTTCT
GATAGACAATCTTCAACCCAGGGTTTACGCAATCCCGGGTGAGCTCTTTCCGGTCCCAACTGCCTACGTTTGGAT
TTTCACTGCCAGGCTAGTAACAGGCCATGGACTGCCGCCAATGGCCAGCCAGTGGGCGACTGGCGCAGGAGCTCT
CTTCACTCTCACAACAATGTTCAGGATCGCCACGGTGGGAAAAGCCTGGCGATCCTGGGTCCCAGGGGGGATTGC
GGTCGCCGTCGGTGAGCCACCTGATTTCCATTCGCAAGTTGCCAGCTCCCTAAAATCACGATCAAACCTAGGCAT
ATACAATGTTCCGTCCTTTACCTTTGGCCGGGCTATAGGAGGTCTACTCAGCTGGTATTGGACGCGAAGATTGCA
ACGATCCGGAACTCCTCTAATTATTGTTGCTTCTGTTAGTCCGCACGAGACGGGAAACGGGACGACGAAGATGCC
TTTGCTGACGCTTTTTCCAAGGGTTTCGTTCTGGGCGAGGGGTTTCTCAGCATTGTCACGTTAATTTTGCAGAGT
TTTGGCGTGCCACATTTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail