Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01807
Gene name
Locationscaffold_02:1038537..1041379
Strand-
Gene length (bp)2842
Transcript length (bp)2676
Coding sequence length (bp)2676
Protein length (aa) 892

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17846 XRN_M Xrn1 helical domain 4.2E-130 331 827
PF03159 XRN_N XRN 5'-3' exonuclease N-terminus 1.2E-100 1 259

GO

GO Term Description Terminal node
GO:0004527 exonuclease activity Yes
GO:0003676 nucleic acid binding Yes
GO:1901363 heterocyclic compound binding No
GO:0004518 nuclease activity No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3628 0.8294 0.2202 0.021 0.1236 0.0008 0.0473 0.012 0.0083 0.0011

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5235
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6282
Ophiocordyceps australis map64 (Brazil) OphauB2|8174
Ophiocordyceps camponoti-floridani Ophcf2|01807 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7590
Ophiocordyceps kimflemingae Ophio5|525
Ophiocordyceps subramaniannii Hirsu2|4336

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01807
MGIPAAFRWLSNKYPKIISSVIEEQPMTLDDGTTIPVDTTSRNPNGEEFDNLYLDMNGIVHPCSHPEDRPAPKDE
EAMMLEVFKYTDRVVNMVRPRKLLMIAVDGVAPRAKMNQQRSRRFRSAQEAKQKEEEKKELLKTLSKDKDATGIS
QSPETITKAFDSNVITPGTPFMDTLAISLRYWCQYKLNTDPAWAKLKIIISDATIPGEGEHKIMSFVRSQRGSTD
YDPNTRHVIYGLDADLIMLGLATHEPHFRVLREDVFFQDRKPRACKLCGQQGHEARNCRGELKEQKEGAEEKTGG
GSLKPFIWLHVSVLREYLAAELSVPGLPFRFDVERAIDDWVFMCCFVGNDFLPHLPALEIREHGIDTLTKIWRDN
LALMGGYVTQDGHINWERAQRILAELAKQEDSILKRRKEQENRREANAKRRKLQNEGPRTAANRADGSRARQTGY
QDPTRGLQLHPIASYPREPPPAITHDMIVNRGHHADANLANKSAANVLKSQLRGEPSFSVLGKRNRSVGEGAGES
AVDGPVARTTGPGTLADDSPVDPVRLGEDGYADRYYQQKFNKDPSDVAFRHAVACAYAEGLAWVLLYYLQGCPSW
DWFYPYHYAPFAADFRDLAGTKFTFDKGYISKPFEQLMSVLPAASRHSLPDVFHELMTSKDSDIIDFYPEEFEID
LNGKKMAWQGVVLLPFIDMPRLLGAVQRLYPQLSPEDALRNSTGRDVLLFADSHESLYNEVSTRFYSKRQGASKF
KVGAATSDGLIGKLEKRDDYVPHGMLRYPLKRHAMPDLDYDRSMSVYYEMPASHLAHKSMLLRGAQLPPPVLTRS
DVETIGGRATRHGRNYGGAPLDRVDAWRGQANRPQGRGQSPPYFASSRGEAPNIPPKAYRGSGWTQ*
Coding >Ophcf2|01807
ATGGGCATTCCGGCTGCCTTCCGATGGCTTTCGAACAAGTATCCAAAGATTATTTCCTCCGTGATAGAGGAACAG
CCCATGACGTTAGACGATGGAACCACTATCCCTGTTGACACCACATCGCGAAATCCCAATGGCGAAGAATTCGAC
AATCTTTACCTCGACATGAACGGCATTGTTCATCCGTGCTCGCATCCAGAGGATAGGCCCGCCCCTAAAGATGAG
GAAGCCATGATGCTGGAAGTTTTCAAATACACTGATCGAGTGGTCAACATGGTTCGACCGCGCAAGCTACTAATG
ATTGCCGTTGATGGTGTTGCGCCCCGTGCTAAGATGAACCAACAAAGATCGAGACGATTTCGTTCGGCGCAGGAA
GCTAAGCAGAAAGAAGAAGAAAAAAAAGAGCTCCTGAAAACCCTCAGTAAAGATAAAGACGCTACGGGGATTTCA
CAGAGCCCTGAAACCATCACGAAAGCATTTGATTCTAATGTCATTACACCCGGAACGCCCTTCATGGACACTCTT
GCTATCAGTTTGCGCTACTGGTGCCAGTACAAGCTTAACACGGATCCCGCTTGGGCGAAGCTCAAGATCATAATC
TCCGACGCAACTATTCCGGGAGAGGGCGAACATAAGATCATGTCCTTTGTTAGGTCGCAGCGCGGATCCACTGAT
TACGACCCAAACACCAGACACGTTATCTATGGACTGGATGCTGATCTCATCATGCTTGGGTTGGCGACTCATGAG
CCTCATTTCAGAGTCCTGCGAGAAGATGTCTTCTTCCAAGACAGAAAGCCGCGAGCGTGCAAGCTCTGCGGTCAG
CAAGGACACGAAGCTCGTAACTGCCGCGGTGAGCTGAAGGAACAGAAGGAGGGGGCCGAGGAGAAGACGGGCGGC
GGGTCTCTGAAACCCTTCATTTGGTTACATGTGTCGGTTCTGCGAGAATACTTGGCCGCGGAGCTTTCAGTCCCT
GGTCTACCGTTTCGTTTCGATGTTGAGCGAGCCATTGACGATTGGGTCTTCATGTGTTGTTTTGTTGGAAACGAC
TTTCTTCCCCATTTACCGGCTTTGGAGATACGCGAGCATGGTATCGACACTTTGACAAAGATCTGGCGAGACAAC
CTGGCCCTGATGGGAGGCTATGTGACTCAAGACGGTCACATCAATTGGGAGAGAGCGCAGCGGATACTGGCCGAG
CTGGCGAAACAGGAAGACTCAATCTTAAAACGCCGTAAAGAGCAGGAGAATCGCCGAGAAGCTAACGCGAAACGA
AGAAAATTGCAAAACGAGGGACCACGCACTGCAGCAAATCGAGCCGATGGGTCAAGAGCACGTCAAACTGGATAT
CAAGATCCGACTCGCGGCCTGCAGCTTCATCCTATTGCGTCATACCCTCGGGAGCCTCCTCCGGCTATCACTCAT
GACATGATTGTCAATCGAGGTCACCATGCTGACGCGAATCTTGCCAACAAGAGCGCGGCAAACGTGCTGAAGTCG
CAACTTCGCGGCGAGCCATCATTTTCGGTCCTTGGGAAGCGCAATCGCTCGGTCGGTGAAGGCGCTGGTGAAAGT
GCCGTGGATGGTCCCGTGGCACGTACGACAGGTCCAGGTACCTTAGCAGACGACAGCCCGGTCGACCCCGTGAGG
CTAGGCGAAGATGGTTATGCGGACCGTTATTACCAGCAAAAGTTCAACAAGGACCCCAGCGACGTGGCCTTTCGT
CACGCAGTGGCTTGTGCCTATGCTGAGGGTCTGGCATGGGTTCTTTTGTACTATCTACAGGGTTGCCCTTCTTGG
GATTGGTTTTACCCTTATCACTACGCGCCATTTGCGGCCGATTTCAGGGATTTGGCCGGCACTAAGTTTACTTTT
GATAAAGGCTACATCTCAAAGCCCTTTGAACAACTTATGAGCGTTCTGCCCGCTGCATCTCGCCATTCGCTTCCC
GATGTCTTTCATGAACTCATGACGAGCAAGGACAGCGACATCATCGATTTTTACCCGGAGGAATTCGAGATCGAC
TTGAACGGCAAGAAAATGGCCTGGCAGGGTGTCGTGCTTTTGCCTTTCATAGACATGCCCCGCCTTCTCGGAGCT
GTTCAGCGACTGTATCCACAACTAAGCCCTGAGGACGCTCTTCGCAACAGCACGGGCCGAGATGTTCTACTTTTC
GCCGATAGCCATGAGAGCTTATACAATGAAGTCTCAACCAGGTTTTATTCGAAACGCCAGGGCGCATCAAAGTTC
AAAGTTGGCGCTGCGACCAGCGACGGCCTCATTGGAAAGCTCGAGAAGCGAGATGACTACGTTCCTCATGGAATG
TTACGATATCCCCTGAAAAGGCATGCCATGCCAGACTTAGACTATGATCGATCAATGAGCGTTTACTATGAAATG
CCCGCATCACACCTGGCTCATAAATCCATGCTTTTGCGAGGCGCTCAGCTGCCCCCGCCTGTCCTGACAAGAAGC
GACGTTGAAACGATCGGGGGCAGAGCTACCAGACACGGTCGAAACTATGGTGGAGCTCCGCTAGATAGAGTCGAT
GCCTGGCGTGGACAAGCAAACAGACCTCAAGGCCGAGGACAGTCCCCCCCCTACTTCGCCAGTTCTAGGGGCGAG
GCACCAAATATACCCCCCAAGGCGTACCGAGGTAGCGGTTGGACTCAGTAG
Transcript >Ophcf2|01807
ATGGGCATTCCGGCTGCCTTCCGATGGCTTTCGAACAAGTATCCAAAGATTATTTCCTCCGTGATAGAGGAACAG
CCCATGACGTTAGACGATGGAACCACTATCCCTGTTGACACCACATCGCGAAATCCCAATGGCGAAGAATTCGAC
AATCTTTACCTCGACATGAACGGCATTGTTCATCCGTGCTCGCATCCAGAGGATAGGCCCGCCCCTAAAGATGAG
GAAGCCATGATGCTGGAAGTTTTCAAATACACTGATCGAGTGGTCAACATGGTTCGACCGCGCAAGCTACTAATG
ATTGCCGTTGATGGTGTTGCGCCCCGTGCTAAGATGAACCAACAAAGATCGAGACGATTTCGTTCGGCGCAGGAA
GCTAAGCAGAAAGAAGAAGAAAAAAAAGAGCTCCTGAAAACCCTCAGTAAAGATAAAGACGCTACGGGGATTTCA
CAGAGCCCTGAAACCATCACGAAAGCATTTGATTCTAATGTCATTACACCCGGAACGCCCTTCATGGACACTCTT
GCTATCAGTTTGCGCTACTGGTGCCAGTACAAGCTTAACACGGATCCCGCTTGGGCGAAGCTCAAGATCATAATC
TCCGACGCAACTATTCCGGGAGAGGGCGAACATAAGATCATGTCCTTTGTTAGGTCGCAGCGCGGATCCACTGAT
TACGACCCAAACACCAGACACGTTATCTATGGACTGGATGCTGATCTCATCATGCTTGGGTTGGCGACTCATGAG
CCTCATTTCAGAGTCCTGCGAGAAGATGTCTTCTTCCAAGACAGAAAGCCGCGAGCGTGCAAGCTCTGCGGTCAG
CAAGGACACGAAGCTCGTAACTGCCGCGGTGAGCTGAAGGAACAGAAGGAGGGGGCCGAGGAGAAGACGGGCGGC
GGGTCTCTGAAACCCTTCATTTGGTTACATGTGTCGGTTCTGCGAGAATACTTGGCCGCGGAGCTTTCAGTCCCT
GGTCTACCGTTTCGTTTCGATGTTGAGCGAGCCATTGACGATTGGGTCTTCATGTGTTGTTTTGTTGGAAACGAC
TTTCTTCCCCATTTACCGGCTTTGGAGATACGCGAGCATGGTATCGACACTTTGACAAAGATCTGGCGAGACAAC
CTGGCCCTGATGGGAGGCTATGTGACTCAAGACGGTCACATCAATTGGGAGAGAGCGCAGCGGATACTGGCCGAG
CTGGCGAAACAGGAAGACTCAATCTTAAAACGCCGTAAAGAGCAGGAGAATCGCCGAGAAGCTAACGCGAAACGA
AGAAAATTGCAAAACGAGGGACCACGCACTGCAGCAAATCGAGCCGATGGGTCAAGAGCACGTCAAACTGGATAT
CAAGATCCGACTCGCGGCCTGCAGCTTCATCCTATTGCGTCATACCCTCGGGAGCCTCCTCCGGCTATCACTCAT
GACATGATTGTCAATCGAGGTCACCATGCTGACGCGAATCTTGCCAACAAGAGCGCGGCAAACGTGCTGAAGTCG
CAACTTCGCGGCGAGCCATCATTTTCGGTCCTTGGGAAGCGCAATCGCTCGGTCGGTGAAGGCGCTGGTGAAAGT
GCCGTGGATGGTCCCGTGGCACGTACGACAGGTCCAGGTACCTTAGCAGACGACAGCCCGGTCGACCCCGTGAGG
CTAGGCGAAGATGGTTATGCGGACCGTTATTACCAGCAAAAGTTCAACAAGGACCCCAGCGACGTGGCCTTTCGT
CACGCAGTGGCTTGTGCCTATGCTGAGGGTCTGGCATGGGTTCTTTTGTACTATCTACAGGGTTGCCCTTCTTGG
GATTGGTTTTACCCTTATCACTACGCGCCATTTGCGGCCGATTTCAGGGATTTGGCCGGCACTAAGTTTACTTTT
GATAAAGGCTACATCTCAAAGCCCTTTGAACAACTTATGAGCGTTCTGCCCGCTGCATCTCGCCATTCGCTTCCC
GATGTCTTTCATGAACTCATGACGAGCAAGGACAGCGACATCATCGATTTTTACCCGGAGGAATTCGAGATCGAC
TTGAACGGCAAGAAAATGGCCTGGCAGGGTGTCGTGCTTTTGCCTTTCATAGACATGCCCCGCCTTCTCGGAGCT
GTTCAGCGACTGTATCCACAACTAAGCCCTGAGGACGCTCTTCGCAACAGCACGGGCCGAGATGTTCTACTTTTC
GCCGATAGCCATGAGAGCTTATACAATGAAGTCTCAACCAGGTTTTATTCGAAACGCCAGGGCGCATCAAAGTTC
AAAGTTGGCGCTGCGACCAGCGACGGCCTCATTGGAAAGCTCGAGAAGCGAGATGACTACGTTCCTCATGGAATG
TTACGATATCCCCTGAAAAGGCATGCCATGCCAGACTTAGACTATGATCGATCAATGAGCGTTTACTATGAAATG
CCCGCATCACACCTGGCTCATAAATCCATGCTTTTGCGAGGCGCTCAGCTGCCCCCGCCTGTCCTGACAAGAAGC
GACGTTGAAACGATCGGGGGCAGAGCTACCAGACACGGTCGAAACTATGGTGGAGCTCCGCTAGATAGAGTCGAT
GCCTGGCGTGGACAAGCAAACAGACCTCAAGGCCGAGGACAGTCCCCCCCCTACTTCGCCAGTTCTAGGGGCGAG
GCACCAAATATACCCCCCAAGGCGTACCGAGGTAGCGGTTGGACTCAGTAG
Gene >Ophcf2|01807
ATGGGCATTCCGGCTGCCTTCCGATGGCTTTCGAACAAGTATCCAAAGATTATTTCCTCCGTGATAGAGGAACAG
CCCATGACGTTAGACGATGGAACCACTATCCCTGTTGACACCACATCGCGAAATCCCAATGGCGAAGAATTCGAC
AATCTTTACCTCGACATGAACGGCATTGTTCATCCGTGCTCGCATCCAGAGGATAGGCCCGCCCCTAAAGATGAG
GAAGCCATGATGCTGGAAGTTTTCAAATACACTGATCGAGTGGTCAACATGGTTCGACCGCGCAAGCTACTAATG
ATTGCCGTTGGTATGTGTCCCAGACCTTGTCTGAAGAGGAAATCCAGACTAATCAATTGCTCTTAGATGGTGTTG
CGCCCCGTGCTAAGATGAACCAACAAAGATCGAGACGATTTCGTTCGGCGCAGGAAGCTAAGCAGAAAGAAGAAG
AAAAAAAAGAGCTCCTGAAAACCCTCAGTAAAGATAAAGACGCTACGGGGATTTCACAGAGCCCTGAAACCATCA
CGAAAGCATTTGATTCTAATGTCATTACACCCGGAACGCCCTTCATGGACACTCTTGCTATCAGTTTGCGCTACT
GGTGCCAGTACAAGCTTAACACGGATCCCGCTTGGGCGAAGCTCAAGATCATAATCTCCGACGCAACTATTCCGG
GAGAGGGCGAACATAAGATCATGTCCTTTGTTAGGTCGCAGCGCGGATCCACTGATTACGACCCAAACACCAGAC
ACGTTATCTATGGACTGGATGCTGATCTCATCATGCTTGGGTTGGCGACTCATGAGCCTCATTTCAGAGTCCTGC
GAGAAGATGTCTTCTTCCAAGACAGAAAGCCGCGAGCGTGCAAGCTCTGCGGTCAGCAAGGACACGAAGCTCGTA
ACTGCCGCGGTGAGCTGAAGGAACAGAAGGAGGGGGCCGAGGAGAAGACGGGCGGCGGGTCTCTGAAACCCTTCA
TTTGGTTACATGTGTCGGTTCTGCGAGAATACTTGGCCGCGGAGCTTTCAGTCCCTGGTCTACCGTTTCGTTTCG
ATGTTGAGCGAGCCATTGACGATTGGGTCTTCATGTGTTGTTTTGTTGGAAACGACTTTCTTCCCCATTTACCGG
CTTTGGAGATACGCGAGCATGGTATCGACACTTTGACAAAGATCTGGCGAGACAACCTGGCCCTGATGGGAGGCT
ATGTGACTCAAGACGGTCACATCAATTGGGAGAGAGCGCAGCGGATACTGGCCGAGCTGGCGAAACAGGAAGACT
CAATCTTAAAACGCCGTAAAGAGCAGGAGAATCGCCGAGAAGCTAACGCGAAACGAAGAAAATTGCAAAACGAGG
GACCACGCACTGCAGCAAATCGAGCCGATGGGTCAAGAGCACGTCAAACTGGATATCAAGATCCGACTCGCGGCC
TGCAGCTTCATCCTATTGCGTCATACCCTCGGGAGCCTCCTCCGGCTATCACTCATGACATGATTGTCAATCGAG
GTCACCATGCTGACGCGAATCTTGCCAACAAGAGCGCGGCAAACGTGCTGAAGTCGCAACTTCGCGGCGAGCCAT
CATTTTCGGTCCTTGGGAAGCGCAATCGCTCGGTCGGTGAAGGCGCTGGTGAAAGTGCCGTGGATGGTCCCGTGG
CACGTACGACAGGTCCAGGTACCTTAGCAGACGACAGCCCGGTCGACCCCGTGAGGCTAGGCGAAGATGGTTATG
CGGACCGTTATTACCAGCAAAAGTTCAACAAGGACCCCAGCGACGTGGCCTTTCGTCACGCAGTGGCTTGTGCCT
ATGCTGAGGGTCTGGCATGGGTTCTTTTGTACTATCTACAGGGTTGCCCTTCTTGGGATTGGTTTTACCCTTATC
ACTACGCGCCATTTGCGGCCGATTTCAGGGATTTGGCCGGCACTAAGTTTACTTTTGATAAAGGCTACATCTCAA
AGCCCTTTGAACAACTTATGAGCGTTCTGCCCGCTGCATCTCGCCATTCGCTTCCCGATGTCTTTCATGAACTCA
TGACGAGCAAGGACAGCGACATCATCGATTTTTACCCGGAGGAATTCGAGATCGACTTGAACGGCAAGAAAATGG
CCTGGCAGGGTGTCGTGCTTTTGCCTTTCATAGACATGCCCCGCCTTCTCGGAGCTGTTCAGCGACTGTATCCAC
AACTAAGCCCTGAGGACGCTCTTCGCAACAGCACGGGCCGAGATGTTCTACTTTTCGCCGATAGCCATGAGAGCT
TATACAATGAAGTCTCAACCAGGTTTTATTCGAAACGCCAGGGCGCATCAAAGTTCAAAGTTGGCGCTGCGACCA
GCGACGGCCTCATTGGAAAGCTCGAGAAGCGAGATGACTACGTTCCTCATGGAATGTTACGATATCCCCTGAAAA
GGCATGCCATGCCAGACTTAGACTATGATCGATCAATGAGGTAACTAATCTTGGGTGTCTCGTGAAATGATGCTG
ATTTCACATTACAGCGTTTACTATGAAATGCCCGCATCACACCTGGCTCATAAATCCATGCTTTTGCGAGGCGCT
CAGCTGCCCCCGCCTGTCCTGACAAGAAGCGACGTTGAAACGATCGGGGGCAGAGCTACCAGACACGGTCGAAAC
TATGGTGGAGCTCCGCTAGATAGAGTCGATGCCTGGCGTGGACAAGGTTAGTCACGTTTGCGTGTCCGGGCAGGT
GCCACGCGTGGCCGCTAATAGTACGATCAAAGCAAACAGACCTCAAGGCCGAGGACAGTCCCCCCCCTACTTCGC
CAGTTCTAGGGGCGAGGCACCAAATATACCCCCCAAGGCGTACCGAGGTAGCGGTTGGACTCAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail