Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01806
Gene name
Locationscaffold_02:1006986..1009849
Strand-
Gene length (bp)2863
Transcript length (bp)1785
Coding sequence length (bp)1785
Protein length (aa) 595

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03142 Chitin_synth_2 Chitin synthase 9.3E-23 254 541
PF13632 Glyco_trans_2_3 Glycosyl transferase family group 2 2.4E-13 255 492
PF13641 Glyco_tranf_2_3 Glycosyltransferase like family 2 1.9E-07 141 417

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 49 71 22
3 99 121 22
4 451 468 17
5 472 494 22
6 501 523 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 80.54 46.01 115.08
Alive In ants, during behavior modification 43.13 24.46 61.81
Dead In ants, recently dead 38.50 21.59 55.41

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000657 yes
Alive Dead 0.543500 no
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01806
MTTIGEWPVRDIVYTSVVGVVMVMACLEWFLWLAAFIYCLVKVFWKAEHWSIRLLCIGVGVAFALLRFIYLPIMV
VTLPLPTQVSQHWPVAAVSFLQWFAFWSFAILLTVPWLFCIYQLVINQLGRTKRIKRVLDDVTAPKVVIVMPCYR
EELEVLVKAINSVVDCDYPPACIHVFLSFDGDQVDDLYLNTVEMLGVSLPVGAAYPRSIDVTYKAARITLSRFPH
GGKRHCQKSTFKLIDKVYAQYLMRNDNLFILFIDSDCILDKVCLQNFVYDMELSPGNTRDMLAMTGVITSTTRKH
SIITLLQDMEYIHGQLFERTVESGCGSVTCLPGALTMLRFSAFRRMAKYYFADKAEQCDDLFDFAKCHLGEDRWL
THLFMIGAKKRHQIQMCTSAFCKTEAVQTYRSLVKQRRRWFLGFVTNEVCMLTDWRLWKRYPTLIIVRFMQNTIR
TTALLFFIMVVALSTTVVKVDNLPVGFIAVSLGLNWLLMLYFGAKLRRFKVWLYPLMFILNPFFNWYYMVYGIFT
AGQRTWGGPRADAAAADSNTTAREAVERAEKQGDELNVVPESFKPAQEARRVASKSTPTTNWILPGNMM*
Coding >Ophcf2|01806
ATGACTACAATTGGCGAGTGGCCGGTCAGAGACATTGTCTACACGTCCGTAGTCGGGGTAGTGATGGTCATGGCC
TGTCTTGAGTGGTTCCTCTGGCTCGCTGCCTTTATTTACTGTCTGGTCAAGGTATTTTGGAAAGCTGAGCACTGG
TCTATCCGTCTCCTTTGCATTGGCGTGGGTGTTGCCTTTGCCTTACTTCGCTTCATCTATCTGCCCATCATGGTG
GTTACGCTTCCTCTTCCGACCCAGGTTTCGCAGCACTGGCCTGTGGCCGCAGTGTCCTTTCTGCAGTGGTTCGCC
TTTTGGAGTTTCGCCATCCTACTTACTGTGCCCTGGCTATTTTGCATTTATCAGCTTGTCATTAATCAGCTCGGT
CGGACCAAACGTATCAAGCGGGTGCTCGACGACGTCACTGCTCCAAAGGTAGTCATTGTTATGCCTTGCTACCGT
GAAGAGCTTGAGGTCCTGGTCAAGGCCATCAACTCAGTTGTCGACTGCGATTATCCACCGGCCTGTATTCATGTG
TTTCTGTCCTTCGATGGCGACCAAGTGGACGATCTCTACCTCAACACAGTGGAGATGTTGGGAGTGTCTCTTCCT
GTGGGCGCGGCGTACCCAAGGAGCATCGACGTGACATACAAGGCGGCCCGCATTACACTCTCTCGCTTCCCACAT
GGTGGCAAGCGACACTGCCAGAAATCTACGTTCAAACTCATTGACAAAGTCTACGCGCAGTATCTGATGAGGAAC
GACAACCTTTTCATCCTCTTCATCGACTCTGATTGCATTCTAGACAAGGTCTGCTTGCAGAATTTTGTCTACGAT
ATGGAGCTCAGCCCAGGAAACACCAGGGATATGCTAGCAATGACCGGCGTCATAACGTCAACGACGCGCAAGCAC
AGTATCATCACGCTCCTCCAAGACATGGAGTATATCCATGGACAGTTGTTCGAGCGCACTGTCGAGTCCGGCTGC
GGATCAGTCACGTGTCTGCCAGGCGCGCTCACCATGCTTCGCTTCTCGGCTTTCAGAAGAATGGCCAAGTATTAT
TTTGCGGATAAAGCGGAGCAATGCGACGATCTTTTCGACTTCGCAAAATGCCACTTGGGTGAAGATCGTTGGCTG
ACACATTTGTTCATGATTGGCGCGAAAAAACGTCACCAAATCCAAATGTGCACGTCTGCCTTTTGCAAGACAGAA
GCTGTGCAGACATATCGATCTCTGGTCAAGCAGCGGCGCCGATGGTTTCTAGGCTTTGTTACCAACGAGGTCTGC
ATGCTGACCGACTGGCGACTTTGGAAGCGATATCCGACCTTGATAATCGTGCGCTTCATGCAGAACACAATTCGT
ACCACAGCCCTACTATTTTTCATCATGGTTGTCGCATTGTCGACGACTGTTGTCAAGGTCGATAACCTCCCGGTG
GGATTCATTGCCGTTTCGCTGGGTCTTAATTGGCTTCTGATGCTTTACTTCGGCGCCAAATTGCGACGTTTTAAA
GTCTGGCTATACCCACTAATGTTTATCCTCAATCCGTTTTTCAACTGGTATTACATGGTTTATGGAATTTTCACT
GCCGGTCAGAGAACTTGGGGCGGGCCGCGAGCCGATGCTGCGGCCGCCGATAGCAATACGACGGCCCGAGAGGCT
GTGGAGCGAGCCGAGAAGCAAGGCGATGAACTCAACGTCGTTCCGGAGTCTTTCAAGCCAGCTCAAGAGGCGCGG
AGAGTCGCAAGCAAGTCGACCCCCACCACAAACTGGATTCTGCCCGGGAACATGATGTAG
Transcript >Ophcf2|01806
ATGACTACAATTGGCGAGTGGCCGGTCAGAGACATTGTCTACACGTCCGTAGTCGGGGTAGTGATGGTCATGGCC
TGTCTTGAGTGGTTCCTCTGGCTCGCTGCCTTTATTTACTGTCTGGTCAAGGTATTTTGGAAAGCTGAGCACTGG
TCTATCCGTCTCCTTTGCATTGGCGTGGGTGTTGCCTTTGCCTTACTTCGCTTCATCTATCTGCCCATCATGGTG
GTTACGCTTCCTCTTCCGACCCAGGTTTCGCAGCACTGGCCTGTGGCCGCAGTGTCCTTTCTGCAGTGGTTCGCC
TTTTGGAGTTTCGCCATCCTACTTACTGTGCCCTGGCTATTTTGCATTTATCAGCTTGTCATTAATCAGCTCGGT
CGGACCAAACGTATCAAGCGGGTGCTCGACGACGTCACTGCTCCAAAGGTAGTCATTGTTATGCCTTGCTACCGT
GAAGAGCTTGAGGTCCTGGTCAAGGCCATCAACTCAGTTGTCGACTGCGATTATCCACCGGCCTGTATTCATGTG
TTTCTGTCCTTCGATGGCGACCAAGTGGACGATCTCTACCTCAACACAGTGGAGATGTTGGGAGTGTCTCTTCCT
GTGGGCGCGGCGTACCCAAGGAGCATCGACGTGACATACAAGGCGGCCCGCATTACACTCTCTCGCTTCCCACAT
GGTGGCAAGCGACACTGCCAGAAATCTACGTTCAAACTCATTGACAAAGTCTACGCGCAGTATCTGATGAGGAAC
GACAACCTTTTCATCCTCTTCATCGACTCTGATTGCATTCTAGACAAGGTCTGCTTGCAGAATTTTGTCTACGAT
ATGGAGCTCAGCCCAGGAAACACCAGGGATATGCTAGCAATGACCGGCGTCATAACGTCAACGACGCGCAAGCAC
AGTATCATCACGCTCCTCCAAGACATGGAGTATATCCATGGACAGTTGTTCGAGCGCACTGTCGAGTCCGGCTGC
GGATCAGTCACGTGTCTGCCAGGCGCGCTCACCATGCTTCGCTTCTCGGCTTTCAGAAGAATGGCCAAGTATTAT
TTTGCGGATAAAGCGGAGCAATGCGACGATCTTTTCGACTTCGCAAAATGCCACTTGGGTGAAGATCGTTGGCTG
ACACATTTGTTCATGATTGGCGCGAAAAAACGTCACCAAATCCAAATGTGCACGTCTGCCTTTTGCAAGACAGAA
GCTGTGCAGACATATCGATCTCTGGTCAAGCAGCGGCGCCGATGGTTTCTAGGCTTTGTTACCAACGAGGTCTGC
ATGCTGACCGACTGGCGACTTTGGAAGCGATATCCGACCTTGATAATCGTGCGCTTCATGCAGAACACAATTCGT
ACCACAGCCCTACTATTTTTCATCATGGTTGTCGCATTGTCGACGACTGTTGTCAAGGTCGATAACCTCCCGGTG
GGATTCATTGCCGTTTCGCTGGGTCTTAATTGGCTTCTGATGCTTTACTTCGGCGCCAAATTGCGACGTTTTAAA
GTCTGGCTATACCCACTAATGTTTATCCTCAATCCGTTTTTCAACTGGTATTACATGGTTTATGGAATTTTCACT
GCCGGTCAGAGAACTTGGGGCGGGCCGCGAGCCGATGCTGCGGCCGCCGATAGCAATACGACGGCCCGAGAGGCT
GTGGAGCGAGCCGAGAAGCAAGGCGATGAACTCAACGTCGTTCCGGAGTCTTTCAAGCCAGCTCAAGAGGCGCGG
AGAGTCGCAAGCAAGTCGACCCCCACCACAAACTGGATTCTGCCCGGGAACATGATGTAG
Gene >Ophcf2|01806
ATGACTACAATTGGCGAGTGGCCGGTCAGAGACGTAGGTGTACCCACGAGCACTGCCCGTATGGACCGACTGATG
CTCACTACTGGGGCAGATTGTCTACACGTCCGTAGTCGGGGTAGTGATGGTCATGGCCTGTCTTGAGTGGTTCCT
CTGGCTCGCTGCCTTTATTTACTGTCTGGTCAAGGTATTTTGGAAAGCTGAGCACTGGTCTATCCGTCTCCTTTG
CATTGGCGTGGGTGTTGCCTTTGCCTTACTTCGGTACGTCCTCAGGCTTTCATGCGTAGGTAGGTATCTTGTACC
GCTGACCAGAATAGCTTCATCTATCTGCCCATCATGGTGGTTACGCTTCCTCTTCCGACCCAGGTTTCGCAGCAC
TGGCCTGTGGCCGCAGTGTCCTTTCTGCAGTGGTTCGCCTTTTGGAGTTTCGCCATCCTACTTACTGTGCCCTGG
CTATTTTGCATTTATCAGCTTGTCATTAATCAGCTCGGTCGGACCAAACGTATCAAGCGGGTGCTCGACGACGTC
ACTGCTCCAAAGGTAGTCATTGTTATGCCTTGCTACCGTGAAGAGCTTGAGGTCCTGGTCAAGGCCATCAACTCA
GTTGTCGACTGCGATTATCCACCGGCCTGTATTCATGTGTTTCTGTCCTTCGATGGCGACCAAGTGGACGATCTC
TACCTCAACACAGTGGAGATGTTGGGAGTGTCTCTTCCTGTGGGCGCGGCGTACCCAAGGAGCATCGACGTGACA
TACAAGGCGGCCCGCATTACACTCTCTCGCTTCCCACATGGTGGCAAGCGACACTGCCAGAAATCTACGTTCAAA
CTCATTGACAAAGTCTACGCGCAGTATCTGATGAGGAACGACAACCTTTTCATCCTCTTCATCGACTCTGATTGC
ATTCTAGACAAGGTCTGCTTGCAGAATTTTGTCTACGATATGGAGCTCAGCCCAGGAAACACCAGGGATATGCTA
GCAATGACCGGCGTCATAACGTCAACGACGCGCAAGCACAGTATCATCACGCTCCTCCAAGACATGGAGTATATC
CATGGACAGTTGTTCGAGCGCACTGTCGAGTCCGGCTGCGGATCAGTCACGTGTCTGCCAGGCGCGCTCACCATG
CTTCGCTTCTCGGCTTTCAGAAGAATGGCCAAGTATTATTTTGCGGATAAAGCGGAGCAATGCGACGATCTTTTC
GACTTCGCAAAATGCCACTTGGGTGAAGATCGTTGGCTGACACATTTGTTCATGATTGGCGCGAAAAAACGTCAC
CAAATCCAAATGTGCACGTCTGCCTTTTGCAAGACAGAAGCTGTGCAGACATATCGATCTCTGGTCAAGCAGCGG
CGCCGATGGTTTCTAGGCTTTGTTACCAACGAGGTCTGCATGCTGACCGACTGGCGACTTTGGAAGCGATATCCG
ACCTTGATAATCGTGCGCTTCATGCAGAACACAATTCGTACCACAGCCCTACTATTTTTCATCATGGTTGTCGCA
TTGTCGACGACTGTTGTCAAGGTCGATAACCTCCCGGTGGGATTCATTGCCGTTTCGCTGGGTCTTAATTGGCTT
CTGATGCTTTACTTCGGCGCCAAATTGCGACGTTTTAAAGTCTGGCTATACCCACTAATGTTTATCCTCAATCCG
TTTTTCAACTGGTATTACATGGTTTATGGAATTTTCACTGCCGGTCAGAGAACTTGGGGCGGGCCGCGAGCCGAT
GCTGCGGCCGCCGATAGCAATACGACGGCCCGAGAGGCTGTGGAGCGAGCCGAGAAGCAAGGCGATGAACTCAAC
GTCGTTCCGGAGTCTTTCAAGCCAGCTCAAGAGGCGCGGAGAGTCGCAAGCAAGTCGACCCCCACCACAGTGGGG
ATCTGCCGGCAGAGGAGCGTTATCAGACCTCCAGATAATATCGATGGCAAATTTTCGGTTCGACGAAGAATGGCG
ACGGGAATCTATGCGCATCCCGATGAAAGTTCAGCATTATGTAGAGACATTCCCACCACAAGGCTAGACGGCTCG
CTCAATTGGTATGAGTCGCTGGAAAGCTTCGACTCCTGTCGCTCAGACTACAAATCTTCATCTGCCGTGATGAAG
GTTGAAAAGTTCATGGGGGAAGAGGATCGACGCAAATATGTCATAGCGCAAAATATGGCCAGATGTAGCGCCAGC
GATAGAGAGCGGATTTCGGGAAATACTACCGGCTAGGAACCCGTACCACTTGGCATCAATGCTACCCAGAGATCA
GCACACACAAGCTTTTATACAAAGGGATGACCGGGAAGAGTTCAATTGTCTGTAGTATATTCTGTGATCCATAGC
CTGCTGCCCGAATTGTTGTTGACCTCAGCCGAGCTTATGAACAGTGTAGGGCACATGAAGATCAGACGGTCGAGT
GGTAATTAACTCGACGTTGTAGTATCAGTGTTATATTCGAGCTCCCAACCACAACGCACCACTCTCCGTCGGGAC
TCCATGCTGCTTGGCGCCCAACGAAGTTCGTAGAGGAGGATTCTGTTCTATGCGGTCTCAATGGCTCTTGGGGAT
CCTCTATACTGTACTTGGATGCCCAGGTGGCCAAACTCTCCGAAGTAGTGTCATAGTCTTCGGCGTGCGCTGGGT
ATCGGTGCGTAGTGCTCATTGATACGCGTGGTTTGCCGCTTGAACCGCCCCGCGACCGCGGAATCACGGGCTTGA
GCCAGCGTGGAAGTTGTACTTGATTGGCTTTGTCCTTGAGCGAACCCCGACTGGCGTGATTGACGACTCGGTGAC
AAGACAATCTACAGAAATCCCAGAAGAAGATGTTGCCCGATGCATTGCAAAAAGCCAGAACTGGATTCTGCCCGG
GAACATGATGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail