Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01803
Gene name
Locationscaffold_02:880443..880873
Strand+
Gene length (bp)430
Transcript length (bp)324
Coding sequence length (bp)324
Protein length (aa) 108

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A) 1.5E-25 8 78

GO

GO Term Description Terminal node
GO:0004751 ribose-5-phosphate isomerase activity Yes
GO:0009052 pentose-phosphate shunt, non-oxidative branch Yes
GO:0071704 organic substance metabolic process No
GO:0008152 metabolic process No
GO:0016861 intramolecular oxidoreductase activity, interconverting aldoses and ketoses No
GO:0016853 isomerase activity No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0009987 cellular process No
GO:0016860 intramolecular oxidoreductase activity No
GO:0003674 molecular_function No
GO:0006091 generation of precursor metabolites and energy No
GO:0044237 cellular metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.45

Transmembrane Domains

Domain # Start End Length
1 73 95 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01803
MINGKPVAIDVAFDGADEIDEDLNLIKGGGACLFQEKLVAISAKRFIAVADYRKQSARLCSTWKTIPLEVLPIAA
PMVFLGKLASALLIIACGSLMRHSLRCFFREM*
Coding >Ophcf2|01803
ATGATTAATGGAAAACCCGTTGCAATAGATGTTGCATTTGACGGTGCTGACGAGATTGATGAAGATCTCAACTTG
ATTAAAGGAGGCGGCGCATGCCTTTTCCAGGAGAAACTGGTAGCAATATCAGCCAAGAGATTTATAGCCGTTGCT
GACTATCGCAAGCAGTCTGCACGGCTCTGTTCGACGTGGAAGACTATCCCACTCGAAGTCTTGCCTATTGCTGCA
CCCATGGTCTTCCTGGGAAAGCTGGCGAGTGCGTTACTGATAATAGCATGTGGATCATTGATGCGCCATTCCCTC
CGCTGCTTCTTCCGCGAGATGTGA
Transcript >Ophcf2|01803
ATGATTAATGGAAAACCCGTTGCAATAGATGTTGCATTTGACGGTGCTGACGAGATTGATGAAGATCTCAACTTG
ATTAAAGGAGGCGGCGCATGCCTTTTCCAGGAGAAACTGGTAGCAATATCAGCCAAGAGATTTATAGCCGTTGCT
GACTATCGCAAGCAGTCTGCACGGCTCTGTTCGACGTGGAAGACTATCCCACTCGAAGTCTTGCCTATTGCTGCA
CCCATGGTCTTCCTGGGAAAGCTGGCGAGTGCGTTACTGATAATAGCATGTGGATCATTGATGCGCCATTCCCTC
CGCTGCTTCTTCCGCGAGATGTGA
Gene >Ophcf2|01803
ATGATTAATGGAAAACCCGTTGCAATAGATGTTGCATTTGACGGTGCTGACGAGATTGATGAAGATCTCAACTTG
ATTAAAGGAGGCGGCGCATGCCTTTTCCAGGAGAAACTGGTAGCAATATCAGCCAAGAGATTTATAGCCGTTGCT
GGTGAGACAATCGAAACTCGAATCGGGAGTGATTAATCGTAACACTCATGTATAGACTATCGCAAGCAGTCTGCA
CGGCTCTGTTCGACGTGGAAGACTATCCCACTCGAAGTCTTGCCTATTGCTGCACCCATGGTGCTTGATCGATTA
AAGGCTCTAGGATCAGCCAACGCAACTCTTCGCTCAGGTCTTCCTGGGAAAGCTGGCGAGTGCGTTACTGATAAT
AGCATGTGGATCATTGATGCGCCATTCCCTCCGCTGCTTCTTCCGCGAGATGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail