Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01801
Gene name
Locationscaffold_02:713215..714496
Strand-
Gene length (bp)1281
Transcript length (bp)1149
Coding sequence length (bp)1149
Protein length (aa) 383

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18261 Rpn9_C Rpn9 C-terminal helix 1.8E-16 344 376
PF01399 PCI PCI domain 1.4E-08 237 336

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.7767 0.5815 0.0681 0.0375 0.1159 0.04 0.0291 0.3611 0.1881 0.0078

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5391
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1306
Ophiocordyceps australis map64 (Brazil) OphauB2|5146
Ophiocordyceps camponoti-floridani Ophcf2|01801 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3264
Ophiocordyceps kimflemingae Ophio5|7914
Ophiocordyceps subramaniannii Hirsu2|5536

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01801
MNAERIPDFLAEQRDQAPEELQGLVLDFENLWERKLWHQLTEALVQFFNHPNSAPQRLSFYKNFILYFADKINQL
KLVDLALKAGTQCKDDHERLEFLQSVAKSVDQENSQDSLVFASVAVARVKLNLNELDEARDDLDAAERILDSFDS
VEAIVHAAFYDANANYYQRKMDYANYYRTALLYLACIDLSLLPAEERHRRAYYLSVAALASNSIYNFGELLLHPI
LDALAQSHEDAWLRELLFAYNRGDLDSYDRLSNNINSNKLLSEHSTHLQQKIYLAALTEAVFRRPPHDRTMTFAT
ISQETKVRHGEIEHLIMKALSLGLLRGTIDEVDQIARISWVQPKVLDMKQIRNMRERLLDWDSNVNQLGNWIETA
GKDVWAA*
Coding >Ophcf2|01801
ATGAATGCCGAACGCATTCCCGATTTCCTCGCGGAACAGCGAGACCAAGCACCCGAGGAACTCCAGGGACTCGTT
CTCGACTTCGAGAACCTTTGGGAGCGAAAGCTGTGGCATCAGCTTACAGAAGCTCTTGTGCAATTTTTCAACCAT
CCCAACAGTGCTCCTCAGCGACTGTCTTTCTACAAGAATTTCATTCTCTATTTCGCCGACAAGATTAACCAACTG
AAGCTGGTTGATTTGGCCTTGAAGGCTGGAACTCAGTGCAAGGATGACCACGAACGTCTTGAATTCCTGCAGTCA
GTGGCGAAAAGTGTCGACCAGGAGAACTCACAGGACTCACTTGTGTTTGCATCTGTGGCTGTGGCAAGAGTGAAG
TTGAATCTGAACGAGCTCGACGAGGCGAGAGACGACCTGGATGCTGCCGAGAGGATTCTAGACTCCTTCGACTCG
GTTGAAGCCATTGTTCACGCGGCGTTCTACGATGCCAATGCAAATTATTATCAACGCAAGATGGATTATGCCAAT
TACTACCGCACCGCACTGCTGTACCTTGCCTGCATAGACTTAAGCTTGCTTCCTGCTGAGGAGCGCCACCGAAGG
GCTTACTATCTCAGCGTCGCCGCCCTGGCATCTAATAGCATCTACAATTTTGGCGAGCTACTTTTACACCCTATC
CTCGATGCACTCGCTCAAAGTCATGAGGATGCCTGGTTGCGAGAGCTTCTCTTTGCCTACAACCGTGGTGACCTG
GACAGCTATGACAGATTGTCCAATAACATTAACTCGAACAAGCTACTCAGCGAACATTCTACCCATCTACAGCAA
AAGATCTATCTTGCAGCCCTTACCGAAGCTGTATTCCGTCGACCTCCACATGATCGAACTATGACGTTTGCGACG
ATTTCGCAAGAAACAAAGGTTCGCCATGGGGAGATTGAGCATCTCATAATGAAAGCCCTGAGCTTGGGTCTCCTT
CGCGGAACAATTGATGAGGTAGATCAGATTGCGCGGATATCCTGGGTGCAGCCAAAGGTGCTGGACATGAAACAA
ATCAGGAATATGAGAGAGCGGTTACTTGACTGGGACTCCAACGTCAACCAACTTGGCAATTGGATTGAGACTGCT
GGCAAGGATGTTTGGGCAGCTTGA
Transcript >Ophcf2|01801
ATGAATGCCGAACGCATTCCCGATTTCCTCGCGGAACAGCGAGACCAAGCACCCGAGGAACTCCAGGGACTCGTT
CTCGACTTCGAGAACCTTTGGGAGCGAAAGCTGTGGCATCAGCTTACAGAAGCTCTTGTGCAATTTTTCAACCAT
CCCAACAGTGCTCCTCAGCGACTGTCTTTCTACAAGAATTTCATTCTCTATTTCGCCGACAAGATTAACCAACTG
AAGCTGGTTGATTTGGCCTTGAAGGCTGGAACTCAGTGCAAGGATGACCACGAACGTCTTGAATTCCTGCAGTCA
GTGGCGAAAAGTGTCGACCAGGAGAACTCACAGGACTCACTTGTGTTTGCATCTGTGGCTGTGGCAAGAGTGAAG
TTGAATCTGAACGAGCTCGACGAGGCGAGAGACGACCTGGATGCTGCCGAGAGGATTCTAGACTCCTTCGACTCG
GTTGAAGCCATTGTTCACGCGGCGTTCTACGATGCCAATGCAAATTATTATCAACGCAAGATGGATTATGCCAAT
TACTACCGCACCGCACTGCTGTACCTTGCCTGCATAGACTTAAGCTTGCTTCCTGCTGAGGAGCGCCACCGAAGG
GCTTACTATCTCAGCGTCGCCGCCCTGGCATCTAATAGCATCTACAATTTTGGCGAGCTACTTTTACACCCTATC
CTCGATGCACTCGCTCAAAGTCATGAGGATGCCTGGTTGCGAGAGCTTCTCTTTGCCTACAACCGTGGTGACCTG
GACAGCTATGACAGATTGTCCAATAACATTAACTCGAACAAGCTACTCAGCGAACATTCTACCCATCTACAGCAA
AAGATCTATCTTGCAGCCCTTACCGAAGCTGTATTCCGTCGACCTCCACATGATCGAACTATGACGTTTGCGACG
ATTTCGCAAGAAACAAAGGTTCGCCATGGGGAGATTGAGCATCTCATAATGAAAGCCCTGAGCTTGGGTCTCCTT
CGCGGAACAATTGATGAGGTAGATCAGATTGCGCGGATATCCTGGGTGCAGCCAAAGGTGCTGGACATGAAACAA
ATCAGGAATATGAGAGAGCGGTTACTTGACTGGGACTCCAACGTCAACCAACTTGGCAATTGGATTGAGACTGCT
GGCAAGGATGTTTGGGCAGCTTGA
Gene >Ophcf2|01801
ATGAATGCCGAACGCATTCCCGATTTCCTCGCGGAACAGCGAGACCAAGCACCCGAGGAACTCCAGGGACTCGTT
CTCGACTTCGAGAACCTTTGGGAGCGAAAGCTGTGGCATCAGCTTACAGAAGCTCTTGTGCAATTTTTCAACCAT
CCCAACAGTGCTCCTCAGCGACTGTCTTTCTACAAGAATTTCATTCTCTATTTCGCCGACAAGATTAACCAACTG
AAGCTGGTTGATTTGGCCTTGAAGGCTGGAACTCAGTGCAAGGGTATGTTTGTTCTGAAGGTCACTCGGTCCACT
ACTGCAGTGCCACTAACGCGCATTTCTAGATGACCACGAACGTCTTGAATTCCTGCAGTCAGTGGCGAAAAGTGT
CGACCAGGAGAACTCACAGGACTCACTTGTGTTTGCATCTGTGGCTGTGGCAAGAGTGAAGTTGAATCTGAACGA
GCTCGACGAGGCGAGAGACGACCTGGATGCTGCCGAGAGGATTCTAGACTCCTTCGACTCGGTTGAAGCCATTGT
TCACGCGGCGTTCTACGATGCCAATGCAAATTATTATCAAGTATTGCCGCTCTCTCAGTTGCCTCGATACGATTA
CACCTTGGACAATCCGAGCTGACCAGCCACTACTAGCGCAAGATGGATTATGCCAATTACTACCGCACCGCACTG
CTGTACCTTGCCTGCATAGACTTAAGCTTGCTTCCTGCTGAGGAGCGCCACCGAAGGGCTTACTATCTCAGCGTC
GCCGCCCTGGCATCTAATAGCATCTACAATTTTGGCGAGCTACTTTTACACCCTATCCTCGATGCACTCGCTCAA
AGTCATGAGGATGCCTGGTTGCGAGAGCTTCTCTTTGCCTACAACCGTGGTGACCTGGACAGCTATGACAGATTG
TCCAATAACATTAACTCGAACAAGCTACTCAGCGAACATTCTACCCATCTACAGCAAAAGATCTATCTTGCAGCC
CTTACCGAAGCTGTATTCCGTCGACCTCCACATGATCGAACTATGACGTTTGCGACGATTTCGCAAGAAACAAAG
GTTCGCCATGGGGAGATTGAGCATCTCATAATGAAAGCCCTGAGCTTGGGTCTCCTTCGCGGAACAATTGATGAG
GTAGATCAGATTGCGCGGATATCCTGGGTGCAGCCAAAGGTGCTGGACATGAAACAAATCAGGAATATGAGAGAG
CGGTTACTTGACTGGGACTCCAACGTCAACCAACTTGGCAATTGGATTGAGACTGCTGGCAAGGATGTTTGGGCA
GCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail