Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01788
Gene name
Locationscaffold_02:488247..491673
Strand+
Gene length (bp)3426
Transcript length (bp)3138
Coding sequence length (bp)3138
Protein length (aa) 1046

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00018 SH3_1 SH3 domain 2.9E-12 8 60
PF00018 SH3_1 SH3 domain 5.0E-06 74 119
PF00018 SH3_1 SH3 domain 2.0E-12 373 420
PF03983 SHD1 SLA1 homology domain 1, SHD1 8.6E-33 486 550
PF14604 SH3_9 Variant SH3 domain 6.9E-11 9 65
PF14604 SH3_9 Variant SH3 domain 2.3E-09 373 424
PF07653 SH3_2 Variant SH3 domain 8.7E-08 7 67

GO

GO Term Description Terminal node
GO:0043130 ubiquitin binding Yes
GO:0042802 identical protein binding Yes
GO:0030674 protein-macromolecule adaptor activity Yes
GO:0008092 cytoskeletal protein binding Yes
GO:0005515 protein binding Yes
GO:0032182 ubiquitin-like protein binding No
GO:0060090 molecular adaptor activity No
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.7054 0.1838 0.0532 0.273 0.0284 0.0213 0.1324 0.23 0.3079 0.0154

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1898
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|289
Ophiocordyceps australis map64 (Brazil) OphauB2|4733
Ophiocordyceps camponoti-floridani Ophcf2|01788 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3254
Ophiocordyceps kimflemingae Ophio5|8313
Ophiocordyceps subramaniannii Hirsu2|1976

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01788
MGFLGVYRAIYDYSPQGEGELTFDDGDLLYILDKNDDDGWWKAKRKAGASDEDEPEGLVPNNYVEPATALSQARA
IYEYTRQTDEELSFPEDALLQIFDTSDPDWILAGHEDEYGFVPSNYIEVQDTTSDVPTASRPAISVLPQRPLSGV
SEQSESAAETSRVSPPESPASTVMHRRPSHPLTSASPSTVGGKRDSRTPISEADEDDEALKSPSLPPRPQPQSAV
SNHGSRGRSPAQVSRDNGQADDTYRTPGGFHLYNINEMVSVMGKRKKMPTTLGVNLKTGTILIAAEHAQDDPAQE
WTAEKMTHYSREGKHVFMELVRPSKSVDFHAGAKDTAEEIVAALGELAGAVRAEGLREVISAASQHSRRHGQVQY
EFMAQGDDEVSVAAGDEVLILDDSKSDEWWQVRSLKTGKEGVVPSSYIEVTRNASLAPAGTGPRTDSVRSTIEQN
RLEEIRLTKEAVRASKESQQRGRRDQGRRDSHSKSKTKPDSSKIKTWTDRTGSFSVEAQFLGLKDGKIQLHKTNG
VKIAVPVAKMSRGDLEYVESVTGLSLEDEKPLADVKRAIRPADKRLPEVGASVGERKRPEYDWFQFFLSCDVAIG
LCERYAQAFVRDSMDESVLPDVNATILRTLGLREGDIIKVMRKLDEKFGRESSKADDGDNGSGGLFSGPGGALRN
NTRKSRPAATTQTNDVVDPTALTSPASDSRSPVGKDGSKSPASKGFEDDAWDSKPSIAVPTTKTSQHASSVAESA
PTPAPPVYAGSMKDLSQLAQPLEPTRASPQPSSNPTPAIMNPQHTSTTNSSMALNPNSSSLQALARQRPLPPSMS
PNQSSLKPPVLQRPSSAPQEVMFLPPGISHPTPGSVQSQVAPPGQSLNDLRLQQQYAAHTAQLQPSMTGYPVLQP
QATAAFPTANPGQQHQQFMQPMMTGMPSVSPFADPGQFQSISSHPTGFQYPKPPQVSVYGQNGGVNSFLPPALQP
QPTGVTALPLRQAGTTGGLVQPLQPLQPQKTGPPPPVRFGVPADVKGLAPQPTGRRANLSQATPDNPFGF*
Coding >Ophcf2|01788
ATGGGGTTCTTGGGCGTGTATCGTGCCATCTACGACTACTCGCCTCAAGGAGAGGGCGAGCTGACCTTTGACGAC
GGGGATTTGCTGTACATTCTCGACAAGAATGATGACGATGGCTGGTGGAAGGCCAAGAGGAAAGCTGGTGCTTCA
GACGAGGATGAGCCCGAGGGTCTCGTACCGAACAACTACGTGGAGCCTGCCACGGCCCTGAGCCAAGCTCGTGCG
ATATACGAGTACACTAGACAAACCGACGAGGAGCTGTCGTTCCCCGAGGATGCTCTGCTCCAAATTTTTGACACG
TCGGATCCTGACTGGATACTCGCCGGCCATGAAGATGAATATGGCTTTGTGCCGTCCAACTACATCGAGGTGCAG
GACACAACATCCGATGTCCCCACAGCTTCACGCCCGGCCATCTCGGTGCTTCCTCAACGACCGCTGTCTGGCGTT
TCGGAACAAAGCGAAAGCGCAGCGGAAACCAGCCGCGTCTCACCCCCGGAAAGTCCGGCGAGCACGGTGATGCAT
CGTCGGCCGTCACATCCGCTTACGTCAGCATCTCCCAGCACTGTTGGGGGCAAGCGAGATTCGCGGACACCGATT
TCGGAAGCAGATGAGGATGATGAAGCTCTAAAGTCCCCTTCATTGCCGCCTCGACCGCAGCCGCAATCCGCTGTC
TCTAATCACGGTTCTCGAGGTCGCTCACCAGCTCAAGTTTCGCGCGACAATGGCCAAGCAGACGATACTTACCGC
ACACCGGGGGGCTTTCACCTCTACAATATCAACGAGATGGTATCCGTCATGGGAAAGCGAAAGAAGATGCCGACG
ACTCTAGGCGTGAACCTCAAGACTGGGACGATTCTCATAGCTGCGGAACACGCGCAGGACGATCCAGCTCAGGAG
TGGACGGCCGAGAAGATGACGCATTACTCACGTGAGGGAAAGCATGTCTTCATGGAGCTCGTTCGACCCAGCAAA
AGCGTCGATTTTCATGCAGGCGCCAAAGATACTGCCGAAGAGATTGTTGCGGCTCTGGGGGAGTTGGCAGGCGCG
GTTCGCGCTGAAGGGCTGAGAGAGGTCATCTCGGCTGCGTCGCAACATTCCCGGCGACACGGCCAGGTTCAGTAT
GAGTTCATGGCCCAAGGCGACGATGAGGTGTCGGTAGCAGCTGGTGATGAAGTGCTAATTCTCGACGACTCGAAA
AGCGATGAATGGTGGCAAGTCCGCTCTTTGAAGACCGGCAAGGAAGGCGTTGTGCCCAGCAGCTATATCGAAGTG
ACGAGAAACGCCTCGTTGGCGCCAGCCGGAACCGGCCCAAGAACGGATTCTGTCCGGTCAACCATTGAGCAGAAT
CGGTTGGAAGAGATCAGGCTCACGAAAGAAGCTGTCAGGGCGAGTAAGGAATCTCAACAGCGAGGGCGACGGGAT
CAAGGACGAAGGGACAGCCATTCAAAGTCCAAAACAAAACCCGACTCATCCAAAATTAAGACATGGACAGACCGG
ACCGGCTCCTTCAGTGTCGAGGCGCAGTTCTTGGGTCTCAAAGACGGTAAAATCCAATTGCACAAGACCAACGGC
GTCAAGATTGCCGTTCCGGTTGCCAAGATGTCGCGGGGTGACCTCGAGTACGTTGAGAGTGTTACCGGTCTTTCT
CTCGAAGACGAAAAGCCCCTGGCAGACGTGAAGAGAGCCATCAGACCGGCAGACAAGCGGCTGCCGGAAGTCGGG
GCTTCGGTTGGAGAAAGAAAAAGGCCGGAATACGACTGGTTCCAGTTCTTCCTGTCCTGCGATGTGGCTATTGGT
CTTTGCGAACGTTACGCTCAGGCCTTTGTTCGAGACTCGATGGACGAGAGCGTCTTGCCCGACGTCAACGCCACC
ATCCTGCGGACTCTGGGTCTACGAGAAGGCGATATCATCAAGGTGATGCGCAAGTTGGACGAGAAGTTTGGCCGC
GAGTCAAGCAAAGCCGATGACGGAGACAACGGTTCGGGCGGACTCTTCTCAGGACCAGGCGGCGCTCTACGAAAT
AACACGCGCAAGTCAAGACCAGCTGCGACGACGCAGACGAACGATGTGGTTGATCCCACGGCACTCACATCTCCA
GCCTCAGACTCTCGATCGCCCGTCGGGAAGGATGGGAGCAAGAGTCCCGCCAGCAAGGGGTTCGAAGACGATGCA
TGGGACTCGAAGCCGTCAATCGCAGTTCCGACGACAAAGACATCTCAACATGCTTCGTCCGTGGCTGAATCCGCC
CCGACTCCGGCGCCTCCAGTCTACGCAGGCTCCATGAAAGACCTTTCGCAACTGGCGCAACCCCTTGAACCGACC
CGGGCAAGTCCACAGCCTTCCTCGAACCCGACGCCAGCCATCATGAACCCACAACACACTTCGACGACCAACTCG
TCAATGGCCCTCAACCCGAATTCCTCGTCTCTCCAGGCTCTAGCCAGGCAGCGGCCACTCCCACCGTCCATGTCA
CCAAACCAGAGCTCGCTCAAGCCGCCCGTCTTGCAGAGACCCTCATCCGCTCCGCAAGAAGTCATGTTCTTGCCC
CCGGGGATATCACACCCGACGCCGGGTTCCGTGCAGTCTCAAGTAGCTCCTCCCGGTCAAAGCTTGAACGACCTC
CGCTTGCAACAGCAGTATGCGGCCCACACGGCCCAACTTCAACCCTCGATGACGGGCTATCCTGTGCTTCAGCCT
CAGGCTACGGCTGCCTTCCCGACGGCGAATCCTGGCCAGCAGCATCAACAATTTATGCAGCCCATGATGACTGGG
ATGCCAAGCGTCAGTCCCTTCGCAGACCCCGGCCAGTTCCAGTCCATCAGCAGCCATCCGACCGGGTTCCAATAC
CCCAAGCCCCCCCAGGTCTCTGTATATGGCCAAAACGGCGGCGTCAACAGCTTCCTACCGCCGGCACTGCAACCG
CAGCCCACTGGCGTGACGGCTCTGCCCCTGAGACAGGCTGGCACAACGGGCGGCTTGGTTCAGCCGTTGCAGCCA
CTGCAGCCACAAAAGACTGGCCCGCCGCCTCCGGTACGGTTCGGAGTTCCAGCGGATGTCAAGGGATTGGCGCCT
CAACCAACCGGGCGTAGAGCGAATCTGTCGCAGGCCACCCCTGATAACCCCTTCGGCTTTTGA
Transcript >Ophcf2|01788
ATGGGGTTCTTGGGCGTGTATCGTGCCATCTACGACTACTCGCCTCAAGGAGAGGGCGAGCTGACCTTTGACGAC
GGGGATTTGCTGTACATTCTCGACAAGAATGATGACGATGGCTGGTGGAAGGCCAAGAGGAAAGCTGGTGCTTCA
GACGAGGATGAGCCCGAGGGTCTCGTACCGAACAACTACGTGGAGCCTGCCACGGCCCTGAGCCAAGCTCGTGCG
ATATACGAGTACACTAGACAAACCGACGAGGAGCTGTCGTTCCCCGAGGATGCTCTGCTCCAAATTTTTGACACG
TCGGATCCTGACTGGATACTCGCCGGCCATGAAGATGAATATGGCTTTGTGCCGTCCAACTACATCGAGGTGCAG
GACACAACATCCGATGTCCCCACAGCTTCACGCCCGGCCATCTCGGTGCTTCCTCAACGACCGCTGTCTGGCGTT
TCGGAACAAAGCGAAAGCGCAGCGGAAACCAGCCGCGTCTCACCCCCGGAAAGTCCGGCGAGCACGGTGATGCAT
CGTCGGCCGTCACATCCGCTTACGTCAGCATCTCCCAGCACTGTTGGGGGCAAGCGAGATTCGCGGACACCGATT
TCGGAAGCAGATGAGGATGATGAAGCTCTAAAGTCCCCTTCATTGCCGCCTCGACCGCAGCCGCAATCCGCTGTC
TCTAATCACGGTTCTCGAGGTCGCTCACCAGCTCAAGTTTCGCGCGACAATGGCCAAGCAGACGATACTTACCGC
ACACCGGGGGGCTTTCACCTCTACAATATCAACGAGATGGTATCCGTCATGGGAAAGCGAAAGAAGATGCCGACG
ACTCTAGGCGTGAACCTCAAGACTGGGACGATTCTCATAGCTGCGGAACACGCGCAGGACGATCCAGCTCAGGAG
TGGACGGCCGAGAAGATGACGCATTACTCACGTGAGGGAAAGCATGTCTTCATGGAGCTCGTTCGACCCAGCAAA
AGCGTCGATTTTCATGCAGGCGCCAAAGATACTGCCGAAGAGATTGTTGCGGCTCTGGGGGAGTTGGCAGGCGCG
GTTCGCGCTGAAGGGCTGAGAGAGGTCATCTCGGCTGCGTCGCAACATTCCCGGCGACACGGCCAGGTTCAGTAT
GAGTTCATGGCCCAAGGCGACGATGAGGTGTCGGTAGCAGCTGGTGATGAAGTGCTAATTCTCGACGACTCGAAA
AGCGATGAATGGTGGCAAGTCCGCTCTTTGAAGACCGGCAAGGAAGGCGTTGTGCCCAGCAGCTATATCGAAGTG
ACGAGAAACGCCTCGTTGGCGCCAGCCGGAACCGGCCCAAGAACGGATTCTGTCCGGTCAACCATTGAGCAGAAT
CGGTTGGAAGAGATCAGGCTCACGAAAGAAGCTGTCAGGGCGAGTAAGGAATCTCAACAGCGAGGGCGACGGGAT
CAAGGACGAAGGGACAGCCATTCAAAGTCCAAAACAAAACCCGACTCATCCAAAATTAAGACATGGACAGACCGG
ACCGGCTCCTTCAGTGTCGAGGCGCAGTTCTTGGGTCTCAAAGACGGTAAAATCCAATTGCACAAGACCAACGGC
GTCAAGATTGCCGTTCCGGTTGCCAAGATGTCGCGGGGTGACCTCGAGTACGTTGAGAGTGTTACCGGTCTTTCT
CTCGAAGACGAAAAGCCCCTGGCAGACGTGAAGAGAGCCATCAGACCGGCAGACAAGCGGCTGCCGGAAGTCGGG
GCTTCGGTTGGAGAAAGAAAAAGGCCGGAATACGACTGGTTCCAGTTCTTCCTGTCCTGCGATGTGGCTATTGGT
CTTTGCGAACGTTACGCTCAGGCCTTTGTTCGAGACTCGATGGACGAGAGCGTCTTGCCCGACGTCAACGCCACC
ATCCTGCGGACTCTGGGTCTACGAGAAGGCGATATCATCAAGGTGATGCGCAAGTTGGACGAGAAGTTTGGCCGC
GAGTCAAGCAAAGCCGATGACGGAGACAACGGTTCGGGCGGACTCTTCTCAGGACCAGGCGGCGCTCTACGAAAT
AACACGCGCAAGTCAAGACCAGCTGCGACGACGCAGACGAACGATGTGGTTGATCCCACGGCACTCACATCTCCA
GCCTCAGACTCTCGATCGCCCGTCGGGAAGGATGGGAGCAAGAGTCCCGCCAGCAAGGGGTTCGAAGACGATGCA
TGGGACTCGAAGCCGTCAATCGCAGTTCCGACGACAAAGACATCTCAACATGCTTCGTCCGTGGCTGAATCCGCC
CCGACTCCGGCGCCTCCAGTCTACGCAGGCTCCATGAAAGACCTTTCGCAACTGGCGCAACCCCTTGAACCGACC
CGGGCAAGTCCACAGCCTTCCTCGAACCCGACGCCAGCCATCATGAACCCACAACACACTTCGACGACCAACTCG
TCAATGGCCCTCAACCCGAATTCCTCGTCTCTCCAGGCTCTAGCCAGGCAGCGGCCACTCCCACCGTCCATGTCA
CCAAACCAGAGCTCGCTCAAGCCGCCCGTCTTGCAGAGACCCTCATCCGCTCCGCAAGAAGTCATGTTCTTGCCC
CCGGGGATATCACACCCGACGCCGGGTTCCGTGCAGTCTCAAGTAGCTCCTCCCGGTCAAAGCTTGAACGACCTC
CGCTTGCAACAGCAGTATGCGGCCCACACGGCCCAACTTCAACCCTCGATGACGGGCTATCCTGTGCTTCAGCCT
CAGGCTACGGCTGCCTTCCCGACGGCGAATCCTGGCCAGCAGCATCAACAATTTATGCAGCCCATGATGACTGGG
ATGCCAAGCGTCAGTCCCTTCGCAGACCCCGGCCAGTTCCAGTCCATCAGCAGCCATCCGACCGGGTTCCAATAC
CCCAAGCCCCCCCAGGTCTCTGTATATGGCCAAAACGGCGGCGTCAACAGCTTCCTACCGCCGGCACTGCAACCG
CAGCCCACTGGCGTGACGGCTCTGCCCCTGAGACAGGCTGGCACAACGGGCGGCTTGGTTCAGCCGTTGCAGCCA
CTGCAGCCACAAAAGACTGGCCCGCCGCCTCCGGTACGGTTCGGAGTTCCAGCGGATGTCAAGGGATTGGCGCCT
CAACCAACCGGGCGTAGAGCGAATCTGTCGCAGGCCACCCCTGATAACCCCTTCGGCTTTTGA
Gene >Ophcf2|01788
ATGGGGTTCTTGGGCGTGTATCGTGCCATCTACGACTACTCGCCTCAAGGAGAGGGCGAGCTGACCTTTGACGAC
GGGGATTTGCTGTACATTCTCGACAAGAATGATGACGATGGCTGGTGGAAGGCCAAGAGGAAAGCTGGTGCTTCA
GACGAGGATGAGCCCGAGGGTCTCGTACCGAACAACTACGTGGAGCCTGTGGGTGCCCTCGCGCATACTCTTATG
ATTGCCTATCGCCATGGTTGATATACAAGCCAAGTTCGCCCTTGTATGCTAATGTTCGCCGCCCTTTTACAAGGC
CACGGCCCTGAGCCAAGCTCGTGCGATATACGAGTACACTAGACAAACCGACGAGGAGCTGTCGTTCCCCGAGGA
TGCTCTGCTCCAAATTTTTGACACGTCGGATCCTGACTGGATACTCGCCGGCCATGAAGATGAATATGGCTTTGT
GCCGTCCAACTACATCGAGGTGCAGGACACAACATCCGATGTCCCCACAGCTTCACGCCCGGCCATCTCGGTGCT
TCCTCAACGACCGCTGTCTGGCGTTTCGGAACAAAGCGAAAGCGCAGCGGAAACCAGCCGCGTCTCACCCCCGGA
AAGTCCGGCGAGCACGGTGATGCATCGTCGGCCGTCACATCCGCTTACGTCAGCATCTCCCAGCACTGTTGGGGG
CAAGCGAGATTCGCGGACACCGATTTCGGAAGCAGATGAGGATGATGAAGCTCTAAAGTCCCCTTCATTGCCGCC
TCGACCGCAGCCGCAATCCGCTGTCTCTAATCACGGTTCTCGAGGTCGCTCACCAGCTCAAGTTTCGCGCGACAA
TGGCCAAGCAGACGATACTTACCGCACACCGGGGGGCTTTCACCTCTACAATATCAACGAGATGGTATCCGTCAT
GGGAAAGCGAAAGAAGATGCCGACGACTCTAGGCGTGAACCTCAAGACTGGGACGATTCTCATAGCTGCGGAACA
CGCGCAGGACGATCCAGCTCAGGAGTGGACGGCCGAGAAGATGACGCATTACTCACGTGAGGGAAAGCATGTCTT
CATGGAGCTCGTTCGACCCAGCAAAAGCGTCGATTTTCATGCAGGCGCCAAAGATACTGCCGAAGAGATTGTTGC
GGCTCTGGGGGAGTTGGCAGGCGCGGTTCGCGCTGAAGGGCTGAGAGAGGTCATCTCGGCTGCGTCGCAACATTC
CCGGCGACACGGCCAGGTTCAGTATGAGTTCATGGCCCAAGGCGACGATGAGGTGTCGGTAGCAGCTGGTGATGA
AGTGCTAATTCTCGACGACTCGAAAAGCGATGAATGGTGGCAAGTCCGCTCTTTGAAGACCGGCAAGGAAGGCGT
TGTGCCCAGCAGCTATATCGAAGTGACGAGAAACGCCTCGTTGGCGCCAGCCGGAACCGGCCCAAGAACGGATTC
TGTCCGGTCAACCATTGAGCAGAATCGGTTGGAAGAGATCAGGCTCACGAAAGAAGCTGTCAGGGCGAGTAAGGA
ATCTCAACAGGTAGGACTCAAGTGTCCGCTTCATCACAGGATGAGCTCCCAAGGAACATGCTGACATGCGTTACC
AGCGAGGGCGACGGGATCAAGGACGAAGGGACAGCCATTCAAAGTCCAAAACAAGTAAGCTGGCAACCTTCGCTG
CCGATGACGTTGCGTCCAAGGCATCGTATTCTGACGATAAACAGAACCCGACTCATCCAAAATTAAGACATGGAC
AGACCGGACCGGCTCCTTCAGTGTCGAGGCGCAGTTCTTGGGTCTCAAAGACGGTAAAATCCAATTGCACAAGAC
CAACGGCGTCAAGATTGCCGTTCCGGTTGCCAAGATGTCGCGGGGTGACCTCGAGTACGTTGAGAGTGTTACCGG
TCTTTCTCTCGAAGACGAAAAGCCCCTGGCAGACGTGAAGAGAGCCATCAGACCGGCAGACAAGCGGCTGCCGGA
AGTCGGGGCTTCGGTTGGAGAAAGAAAAAGGCCGGAATACGACTGGTTCCAGTTCTTCCTGTCCTGCGATGTGGC
TATTGGTCTTTGCGAACGTTACGCTCAGGCCTTTGTTCGAGACTCGATGGACGAGAGCGTCTTGCCCGACGTCAA
CGCCACCATCCTGCGGACTCTGGGTCTACGAGAAGGCGATATCATCAAGGTGATGCGCAAGTTGGACGAGAAGTT
TGGCCGCGAGTCAAGCAAAGCCGATGACGGAGACAACGGTTCGGGCGGACTCTTCTCAGGACCAGGCGGCGCTCT
ACGAAATAACACGCGCAAGTCAAGACCAGCTGCGACGACGCAGACGAACGATGTGGTTGATCCCACGGCACTCAC
ATCTCCAGCCTCAGACTCTCGATCGCCCGTCGGGAAGGATGGGAGCAAGAGTCCCGCCAGCAAGGGGTTCGAAGA
CGATGCATGGGACTCGAAGCCGTCAATCGCAGTTCCGACGACAAAGACATCTCAACATGCTTCGTCCGTGGCTGA
ATCCGCCCCGACTCCGGCGCCTCCAGTCTACGCAGGCTCCATGAAAGACCTTTCGCAACTGGCGCAACCCCTTGA
ACCGACCCGGGCAAGTCCACAGCCTTCCTCGAACCCGACGCCAGCCATCATGAACCCACAACACACTTCGACGAC
CAACTCGTCAATGGCCCTCAACCCGAATTCCTCGTCTCTCCAGGCTCTAGCCAGGCAGCGGCCACTCCCACCGTC
CATGTCACCAAACCAGAGCTCGCTCAAGCCGCCCGTCTTGCAGAGACCCTCATCCGCTCCGCAAGAAGTCATGTT
CTTGCCCCCGGGGATATCACACCCGACGCCGGGTTCCGTGCAGTCTCAAGTAGCTCCTCCCGGTCAAAGCTTGAA
CGACCTCCGCTTGCAACAGCAGTATGCGGCCCACACGGCCCAACTTCAACCCTCGATGACGGGCTATCCTGTGCT
TCAGCCTCAGGCTACGGCTGCCTTCCCGACGGCGAATCCTGGCCAGCAGCATCAACAATTTATGCAGCCCATGAT
GACTGGGATGCCAAGCGTCAGTCCCTTCGCAGACCCCGGCCAGTTCCAGTCCATCAGCAGCCATCCGACCGGGTT
CCAATACCCCAAGCCCCCCCAGGTCTCTGTATATGGCCAAAACGGCGGCGTCAACAGCTTCCTACCGCCGGCACT
GCAACCGCAGCCCACTGGCGTGACGGCTCTGCCCCTGAGACAGGCTGGCACAACGGGCGGCTTGGTTCAGCCGTT
GCAGCCACTGCAGCCACAAAAGACTGGCCCGCCGCCTCCGGTACGGTTCGGAGTTCCAGCGGATGTCAAGGGATT
GGCGCCTCAACCAACCGGGCGTAGAGCGAATCTGTCGCAGGCCAGTGAGTATCTCGTCTTCACCGCACGTGCCGA
CCCGATGATTAATTCTTTTCCTCAGCCCCTGATAACCCCTTCGGCTTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail