Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01782
Gene name
Locationscaffold_02:443738..451062
Strand+
Gene length (bp)7324
Transcript length (bp)5952
Coding sequence length (bp)5952
Protein length (aa) 1984

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02364 Glucan_synthase 1,3-beta-glucan synthase component 0.0E+00 889 1712
PF14288 FKS1_dom1 1,3-beta-glucan synthase subunit FKS1, domain-1 7.6E-44 378 485

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0003843 1,3-beta-D-glucan synthase activity Yes
GO:0006075 (1->3)-beta-D-glucan biosynthetic process Yes
GO:0000148 1,3-beta-D-glucan synthase complex Yes
GO:0035251 UDP-glucosyltransferase activity No
GO:0016051 carbohydrate biosynthetic process No
GO:0006073 cellular glucan metabolic process No
GO:0032991 protein-containing complex No
GO:0009250 glucan biosynthetic process No
GO:0043170 macromolecule metabolic process No
GO:0044262 cellular carbohydrate metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0009058 biosynthetic process No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0006074 (1->3)-beta-D-glucan metabolic process No
GO:0008152 metabolic process No
GO:0033692 cellular polysaccharide biosynthetic process No
GO:0009987 cellular process No
GO:0000271 polysaccharide biosynthetic process No
GO:1990234 transferase complex No
GO:0110165 cellular anatomical entity No
GO:0044237 cellular metabolic process No
GO:0005975 carbohydrate metabolic process No
GO:0016757 glycosyltransferase activity No
GO:1902494 catalytic complex No
GO:0034637 cellular carbohydrate biosynthetic process No
GO:0008150 biological_process No
GO:0044249 cellular biosynthetic process No
GO:0098796 membrane protein complex No
GO:0046527 glucosyltransferase activity No
GO:0008194 UDP-glycosyltransferase activity No
GO:0044264 cellular polysaccharide metabolic process No
GO:0044042 glucan metabolic process No
GO:0009059 macromolecule biosynthetic process No
GO:0005976 polysaccharide metabolic process No
GO:0003674 molecular_function No
GO:0098797 plasma membrane protein complex No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0051273 beta-glucan metabolic process No
GO:0005575 cellular_component No
GO:0044238 primary metabolic process No
GO:0016758 hexosyltransferase activity No
GO:0051274 beta-glucan biosynthetic process No
GO:0071704 organic substance metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

Domain # Start End Length
1 532 554 22
2 574 596 22
3 611 630 19
4 643 665 22
5 696 718 22
6 756 778 22
7 1376 1398 22
8 1435 1452 17
9 1522 1544 22
10 1551 1573 22
11 1637 1659 22
12 1684 1706 22
13 1726 1748 22
14 1755 1777 22
15 1819 1841 22
16 1880 1902 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01782
MRTRRFIHTQPAPHDYEHRISHSTLRWSRSTSARDAVALVWHLYAVRCVSKINPLSKCGHTDSYYQDDQYYDNGY
DARGGQGAHGNAGDGYYDESGYYNADPNNPYHQDGGYYDGHDQYQDDYYNGQGGGYYDNEYNNGYAANSGRHGSE
EDSETFSDFTMRSDMARAAEMDYYGRGDERHNSYGDGQRGYRPPSSQLSYGANRSSGASTPNYGMDYGNVLPAGQ
RSREPYPAWTSDAQIPLSKEEIEDIFMDLTAKFGFQRDSMRNMYDHLMTLLDSRASRMTPNQALLSLHADYIGGD
NANYRKWYFAAHLDLDDAVGFANAKSKGLRRKAKNKKKKAGDAANEDEALQDLEGDNSLEAAEYRWKTRMNRMSQ
HDRVRQIALYLLCWGEANQVRFMPECLCFVFKCADDYLNSPACQALVEPVDEFTYLNNVITPLYQYCRNQGYEIL
NGVYVRRERDHKHIIGYDDCNQLFWYPEGIERIVLQDKSKLVDVPPAERYLKLKDVEWKKCFFKTYKETRSWGHL
LVNFNRIWIIHLTMFWFYTAHNAPTLIVGNAYEQQVNNQPPASKQFSVVAFGGAIAAFIQILATLAEWAYVPRRW
AGAQHLTKKLLFLMLIFAINVGPGVKVFVIPTKKDKVDIDLIIGIVHFVIAVITFLFFAVMPLGGLFGSYLTKNS
RRYVASQTFTASYPKLSGNDMAMSYGLWLTVFGAKFGESYVYLTLSFRDVIRYLSIFHPRCQGDHMFGAAATILC
KNHPAILLGLMAFTDLIFFFLDTYLFYVLLNTIFSIARSFYIGSSIWTPWRNIFSRLPKRIYSKVLATTDMEIKY
KPKVLISQVWNAIVISMYREHLLAIDHVQKLLYHQVPSEQEGKRTLRAPTFFVSQEDHSFKTEFFPSHSEAERRI
SFFAQSLSTPIPEPLPVDNMPTFTVMIPHYSEKILLSLREIIREDEPYSRVTLLEYLKQLHPHEWDCFVKDTKIL
ADETSQMNGEFEKSEKDAAKSKIDDLPFYCIGFKSSAPEYTLRTRIWASLRSQTLYRTVSGFMNYSRAIKLLYRV
ENPEVVQMFGGNSDKLERELERMARRKFKIVVSMQRYSKFKKEEMENAEFLLRAYPDLQIAYLDEEPPVAEGEEP
RLYSALIDGHSELMENGMRRPKFRIQLSGNPVLGDGKSDNQNHSLIFYRGEYIQLIDANQDNYLEECLKIRSVLA
EFEEMKTENVSPYTPGVKNEVSAPVAILGAREYIFSENIGILGDVAAGKEQTFGTLFARTLAQIGGKLHYGHPDF
LNGIFMTTRGGVSKAQKGLHLNEDIFAGMNAILRGGRIKHCEYYQCGKGRDLGFGSILNFTTKIGTGMGEQMLSR
EYYYLGTQLPLDRFLSFYYAHPGFHINNMFIMLSVQLFMLTLLNFGAFKHETIACDYNRNKPLTDPLFPTGCANT
DAVMDWVQRSIFSIFFVFFLSFVPLIVQELTERGVWRALVRFLKQFFSLSPFFEVFVCQIYANSVQQDLSFGGAR
YIGTGRGFATARIPFGVLYSRFAGPSIYFGARLLMILLFATVTAWQAALTYFWITLLGLTISPFLYNPHQFAWND
FFIDYRDFLRWLSRGNSRSHASSWIAFCRLSRTRITGYKRKALGEASAKMSADVPRAAIANIFFTEILTPLMQVV
WTLIPYLFINAQTGVLSAKNKDADIKPTDSLIRVLVVALAPIGINAGVLGAMFAMACFMGPVLSMCCKKFGSVLA
AIAHGAAAVFMLIFFEAMFVLEGFNFARTLAGMIAVVAIQRFIFKLIVSLALTREMKTDQSNVAFWTGKWYSMGW
HSVSQPAREFLCKITELSMFAADFILGHWLLFLMLPIILIPQVDKLHSMMLFWLRPSRQIRPPIYSMKQSKLRRR
RVVRYAMLYFVLLAVFLGLIVGPILAGDKIPPKILRQIGDQTSLSHKFRLMQPNAQDKDNTNGTEETGTGRPGYS
GAFTKSTTRTGAAEPTGGGGGGGGGGGGGGTIG*
Coding >Ophcf2|01782
ATGCGGACACGACGTTTTATACATACGCAGCCAGCTCCCCACGACTACGAGCACCGCATCTCGCACTCCACCCTT
CGTTGGTCCCGCTCGACTTCGGCTCGTGACGCGGTCGCTTTGGTTTGGCACCTCTACGCGGTTCGATGTGTGTCG
AAGATTAATCCTCTGTCAAAATGCGGCCATACCGATTCGTACTATCAAGATGACCAATATTACGACAACGGCTAC
GACGCTCGAGGCGGCCAAGGAGCCCACGGCAATGCTGGCGACGGCTACTACGACGAATCGGGATACTACAATGCC
GATCCCAACAACCCATATCACCAGGATGGAGGATACTATGATGGCCACGACCAGTATCAGGACGACTATTACAAC
GGCCAGGGCGGCGGCTACTACGACAACGAGTACAACAACGGGTACGCTGCCAACAGCGGTCGGCACGGTTCTGAA
GAGGACTCGGAGACCTTTAGCGACTTCACCATGAGGTCTGACATGGCCCGAGCCGCTGAGATGGACTATTACGGG
CGCGGCGATGAGCGCCATAACAGTTACGGTGATGGGCAGCGAGGGTATCGCCCGCCCTCCTCGCAGCTGTCGTAC
GGCGCGAATCGCTCGTCTGGCGCGTCCACTCCCAACTATGGCATGGACTACGGCAACGTGCTGCCAGCTGGCCAA
CGATCCCGGGAGCCGTACCCTGCCTGGACTTCGGACGCACAGATTCCCCTCTCCAAGGAGGAAATCGAGGATATC
TTTATGGACTTGACTGCAAAGTTTGGCTTCCAGCGAGACAGCATGCGCAACATGTATGACCACCTCATGACGCTG
CTCGACTCCAGAGCTTCTCGCATGACGCCCAACCAAGCACTGCTGTCCCTCCACGCCGATTACATTGGTGGAGAC
AACGCCAACTATCGGAAGTGGTATTTCGCCGCCCACCTTGATCTGGACGACGCCGTCGGCTTCGCCAACGCAAAG
AGCAAGGGCCTGCGTCGGAAGGCCAAGAACAAGAAGAAGAAGGCGGGTGATGCCGCCAACGAAGACGAGGCTCTG
CAGGATCTTGAGGGCGACAACAGCTTGGAAGCGGCCGAATACCGCTGGAAGACTCGGATGAATCGCATGTCGCAG
CATGATCGTGTGCGCCAGATCGCACTCTACCTCCTCTGCTGGGGCGAAGCAAATCAAGTCCGATTCATGCCCGAG
TGTCTCTGCTTCGTCTTCAAATGCGCCGACGACTACCTCAACTCGCCCGCCTGCCAGGCCCTCGTGGAGCCTGTC
GACGAGTTCACGTACCTGAACAACGTCATCACTCCCCTTTACCAGTACTGCCGCAACCAGGGCTACGAGATCCTT
AACGGGGTCTACGTTCGCCGCGAGCGCGACCACAAGCACATCATCGGTTATGACGACTGCAACCAGCTGTTCTGG
TACCCTGAAGGCATCGAGCGCATCGTCCTGCAGGATAAGAGCAAGCTGGTCGACGTTCCGCCTGCTGAGCGATAC
CTGAAGCTCAAGGACGTCGAATGGAAGAAGTGCTTCTTCAAGACGTACAAGGAGACGCGGTCCTGGGGTCACCTC
TTGGTCAACTTCAACCGCATCTGGATCATTCATCTTACCATGTTCTGGTTCTACACGGCACACAACGCGCCCACC
CTCATCGTCGGCAACGCGTACGAGCAGCAGGTTAACAACCAGCCGCCCGCGTCGAAGCAATTTTCCGTCGTCGCG
TTCGGCGGTGCCATTGCCGCCTTCATCCAGATTCTGGCGACCTTGGCCGAATGGGCCTACGTTCCCCGCCGATGG
GCTGGCGCCCAGCATCTGACAAAGAAGCTCCTCTTCCTCATGCTCATCTTTGCCATCAACGTCGGGCCCGGGGTC
AAGGTCTTTGTGATCCCTACGAAGAAGGACAAGGTCGACATCGACCTCATTATTGGCATCGTGCACTTTGTCATT
GCCGTCATCACCTTCCTCTTCTTCGCCGTTATGCCGCTCGGTGGACTGTTTGGCAGCTACCTCACCAAGAACTCG
AGACGTTATGTCGCCAGCCAGACCTTCACGGCCAGCTATCCTAAACTATCTGGCAACGACATGGCCATGTCGTAC
GGCCTGTGGCTGACCGTGTTTGGCGCCAAATTTGGCGAGTCCTACGTCTACCTCACGCTCTCTTTCCGAGATGTG
ATCCGCTATCTTTCCATCTTCCACCCCAGGTGCCAGGGCGATCACATGTTCGGCGCGGCTGCCACCATCCTCTGC
AAGAATCACCCGGCCATACTACTCGGCTTGATGGCGTTCACGGACCTCATCTTCTTCTTCCTCGATACCTACCTC
TTCTACGTCCTCCTCAACACCATCTTCTCTATTGCTCGGTCTTTCTACATCGGATCTTCCATTTGGACCCCGTGG
AGGAACATCTTCTCCCGCCTTCCGAAGAGGATCTACTCCAAAGTCCTGGCCACGACCGACATGGAGATCAAGTAC
AAGCCCAAGGTGCTGATATCGCAGGTCTGGAATGCTATCGTCATCTCCATGTATCGCGAGCATCTCCTGGCCATC
GACCACGTCCAGAAGCTGCTGTATCACCAGGTGCCGTCCGAGCAAGAGGGGAAGCGCACCCTGCGCGCTCCGACC
TTTTTCGTCTCTCAGGAAGACCATTCGTTCAAGACGGAGTTTTTCCCCAGCCATAGTGAGGCAGAGCGCCGCATC
TCCTTCTTCGCCCAGTCGCTGTCGACCCCCATCCCGGAGCCTCTTCCGGTGGATAACATGCCGACGTTCACGGTC
ATGATTCCTCACTACAGCGAGAAGATCCTGCTGTCCCTGCGCGAAATCATCCGCGAGGATGAACCGTATTCTCGA
GTGACCCTCTTGGAGTACCTCAAACAGCTGCACCCCCACGAGTGGGACTGCTTCGTCAAGGACACCAAGATCCTG
GCCGACGAGACGTCGCAGATGAATGGCGAATTCGAGAAGAGCGAGAAGGACGCCGCAAAGAGCAAGATTGACGAC
CTTCCCTTCTACTGCATCGGCTTCAAGTCCTCGGCTCCCGAGTACACCCTGCGGACTCGAATCTGGGCCTCGCTT
CGTTCTCAGACCCTGTACCGTACAGTCTCGGGCTTCATGAACTACAGCCGTGCCATCAAGCTCTTGTACCGAGTG
GAGAACCCGGAGGTAGTCCAGATGTTTGGCGGCAACTCCGACAAGCTCGAACGGGAACTGGAACGCATGGCTCGC
CGAAAGTTCAAGATTGTCGTTTCGATGCAGCGCTACTCCAAGTTCAAGAAGGAGGAGATGGAAAATGCCGAATTC
CTGCTTCGCGCGTATCCCGATTTGCAGATTGCCTATCTCGACGAGGAGCCTCCTGTTGCCGAGGGTGAGGAGCCC
CGGCTATACTCGGCTCTGATCGACGGCCACTCGGAGCTCATGGAGAACGGCATGCGACGACCAAAGTTCAGGATC
CAGCTCTCCGGCAACCCTGTTCTCGGTGACGGCAAATCGGACAACCAGAACCACTCTCTCATCTTCTACCGCGGC
GAATACATCCAACTCATCGATGCGAACCAGGACAACTACCTCGAGGAGTGCCTCAAGATCCGCAGCGTGCTGGCC
GAGTTTGAAGAGATGAAGACGGAGAACGTATCCCCATATACTCCAGGTGTCAAGAACGAGGTCTCCGCTCCGGTC
GCGATTCTTGGAGCCCGCGAGTACATCTTCTCCGAGAACATCGGCATCTTGGGAGACGTCGCCGCCGGTAAGGAA
CAGACGTTCGGAACGCTGTTTGCTCGTACCCTTGCGCAGATTGGAGGCAAGCTGCACTATGGTCACCCTGATTTC
CTCAACGGCATCTTCATGACGACTCGTGGCGGCGTGTCCAAGGCGCAGAAGGGCTTGCATCTCAACGAGGACATT
TTCGCCGGCATGAACGCCATCCTCCGCGGCGGGCGCATCAAGCATTGTGAATACTACCAGTGCGGCAAGGGTCGT
GATCTTGGTTTCGGCTCCATTCTCAACTTCACGACCAAGATTGGAACCGGCATGGGAGAACAGATGCTCTCTCGA
GAGTACTACTACCTAGGCACACAGCTTCCTCTTGACCGATTCCTATCCTTCTACTACGCCCATCCCGGTTTCCAC
ATCAACAACATGTTCATCATGCTCTCTGTCCAGCTCTTCATGCTCACGCTGCTCAATTTCGGCGCCTTCAAACAC
GAGACGATTGCCTGCGACTACAACCGGAACAAGCCGCTGACGGACCCCCTCTTCCCCACGGGATGCGCCAACACG
GACGCCGTCATGGACTGGGTTCAGCGCAGCATCTTCTCCATCTTCTTCGTCTTCTTCCTGTCGTTCGTGCCGCTC
ATCGTCCAGGAACTGACGGAACGTGGCGTGTGGCGCGCCCTGGTCCGCTTCCTGAAGCAGTTCTTCTCGCTCTCG
CCATTCTTCGAGGTGTTTGTCTGCCAGATTTACGCGAACTCTGTGCAGCAGGATCTTTCGTTTGGCGGTGCGCGA
TACATCGGAACCGGGCGTGGTTTCGCCACGGCGCGTATCCCCTTTGGCGTCTTGTACTCGCGCTTCGCCGGGCCG
TCGATCTACTTTGGCGCCAGGCTCTTGATGATTCTCCTCTTCGCCACGGTCACGGCCTGGCAGGCGGCTCTGACG
TATTTCTGGATCACGCTGCTCGGCCTCACCATCTCGCCGTTCCTTTACAATCCGCATCAATTCGCCTGGAACGAC
TTCTTCATCGACTATCGGGATTTCTTGCGCTGGCTCTCCAGAGGCAACTCGCGGAGCCACGCGTCGTCGTGGATC
GCCTTTTGCCGTCTTTCGCGGACTCGGATCACGGGTTACAAGCGCAAGGCCCTGGGCGAGGCCTCGGCCAAGATG
TCGGCCGATGTCCCGCGCGCTGCCATTGCCAACATTTTCTTCACGGAGATCCTGACGCCCCTTATGCAGGTCGTT
TGGACCCTGATTCCATACTTGTTCATCAATGCGCAGACGGGTGTCTTGAGCGCCAAGAACAAGGACGCCGACATC
AAGCCCACGGACTCTCTGATCCGCGTCCTCGTCGTCGCCTTGGCACCCATAGGCATCAACGCCGGAGTCCTCGGG
GCCATGTTCGCCATGGCTTGCTTCATGGGCCCTGTCCTCAGCATGTGCTGCAAGAAGTTCGGCAGCGTCCTGGCG
GCCATTGCCCACGGCGCGGCTGCCGTCTTCATGCTCATCTTCTTCGAGGCCATGTTCGTTCTTGAGGGCTTCAAT
TTTGCCAGGACCCTCGCCGGAATGATTGCCGTCGTGGCCATCCAGAGGTTCATCTTCAAGCTCATCGTCTCTCTC
GCCTTGACTCGCGAGATGAAGACGGATCAGTCCAACGTCGCCTTCTGGACGGGCAAGTGGTACTCGATGGGCTGG
CATTCCGTGTCACAACCCGCGCGCGAGTTCCTGTGCAAGATTACGGAATTGAGCATGTTCGCGGCTGACTTCATC
CTGGGCCACTGGCTGCTGTTCCTGATGCTGCCCATCATCCTAATCCCGCAGGTCGACAAACTTCACTCGATGATG
CTCTTCTGGCTGAGACCCAGTCGACAAATTCGGCCTCCGATTTACTCGATGAAACAGTCCAAGCTGAGGCGGCGC
AGAGTGGTTCGATATGCCATGCTCTACTTTGTGCTCTTGGCCGTCTTCCTTGGACTGATTGTTGGTCCCATCTTG
GCCGGCGACAAGATACCTCCCAAGATTCTCAGGCAAATCGGCGACCAGACGTCTCTGTCGCACAAGTTCCGTCTC
ATGCAGCCAAACGCCCAAGACAAGGACAACACGAACGGCACCGAGGAAACGGGGACTGGCAGACCGGGCTACAGC
GGTGCCTTTACCAAGTCGACAACCAGAACGGGGGCCGCTGAACCGACGGGTGGCGGCGGCGGCGGCGGCGGTGGT
GGAGGAGGAGGAGGAACAATAGGATAA
Transcript >Ophcf2|01782
ATGCGGACACGACGTTTTATACATACGCAGCCAGCTCCCCACGACTACGAGCACCGCATCTCGCACTCCACCCTT
CGTTGGTCCCGCTCGACTTCGGCTCGTGACGCGGTCGCTTTGGTTTGGCACCTCTACGCGGTTCGATGTGTGTCG
AAGATTAATCCTCTGTCAAAATGCGGCCATACCGATTCGTACTATCAAGATGACCAATATTACGACAACGGCTAC
GACGCTCGAGGCGGCCAAGGAGCCCACGGCAATGCTGGCGACGGCTACTACGACGAATCGGGATACTACAATGCC
GATCCCAACAACCCATATCACCAGGATGGAGGATACTATGATGGCCACGACCAGTATCAGGACGACTATTACAAC
GGCCAGGGCGGCGGCTACTACGACAACGAGTACAACAACGGGTACGCTGCCAACAGCGGTCGGCACGGTTCTGAA
GAGGACTCGGAGACCTTTAGCGACTTCACCATGAGGTCTGACATGGCCCGAGCCGCTGAGATGGACTATTACGGG
CGCGGCGATGAGCGCCATAACAGTTACGGTGATGGGCAGCGAGGGTATCGCCCGCCCTCCTCGCAGCTGTCGTAC
GGCGCGAATCGCTCGTCTGGCGCGTCCACTCCCAACTATGGCATGGACTACGGCAACGTGCTGCCAGCTGGCCAA
CGATCCCGGGAGCCGTACCCTGCCTGGACTTCGGACGCACAGATTCCCCTCTCCAAGGAGGAAATCGAGGATATC
TTTATGGACTTGACTGCAAAGTTTGGCTTCCAGCGAGACAGCATGCGCAACATGTATGACCACCTCATGACGCTG
CTCGACTCCAGAGCTTCTCGCATGACGCCCAACCAAGCACTGCTGTCCCTCCACGCCGATTACATTGGTGGAGAC
AACGCCAACTATCGGAAGTGGTATTTCGCCGCCCACCTTGATCTGGACGACGCCGTCGGCTTCGCCAACGCAAAG
AGCAAGGGCCTGCGTCGGAAGGCCAAGAACAAGAAGAAGAAGGCGGGTGATGCCGCCAACGAAGACGAGGCTCTG
CAGGATCTTGAGGGCGACAACAGCTTGGAAGCGGCCGAATACCGCTGGAAGACTCGGATGAATCGCATGTCGCAG
CATGATCGTGTGCGCCAGATCGCACTCTACCTCCTCTGCTGGGGCGAAGCAAATCAAGTCCGATTCATGCCCGAG
TGTCTCTGCTTCGTCTTCAAATGCGCCGACGACTACCTCAACTCGCCCGCCTGCCAGGCCCTCGTGGAGCCTGTC
GACGAGTTCACGTACCTGAACAACGTCATCACTCCCCTTTACCAGTACTGCCGCAACCAGGGCTACGAGATCCTT
AACGGGGTCTACGTTCGCCGCGAGCGCGACCACAAGCACATCATCGGTTATGACGACTGCAACCAGCTGTTCTGG
TACCCTGAAGGCATCGAGCGCATCGTCCTGCAGGATAAGAGCAAGCTGGTCGACGTTCCGCCTGCTGAGCGATAC
CTGAAGCTCAAGGACGTCGAATGGAAGAAGTGCTTCTTCAAGACGTACAAGGAGACGCGGTCCTGGGGTCACCTC
TTGGTCAACTTCAACCGCATCTGGATCATTCATCTTACCATGTTCTGGTTCTACACGGCACACAACGCGCCCACC
CTCATCGTCGGCAACGCGTACGAGCAGCAGGTTAACAACCAGCCGCCCGCGTCGAAGCAATTTTCCGTCGTCGCG
TTCGGCGGTGCCATTGCCGCCTTCATCCAGATTCTGGCGACCTTGGCCGAATGGGCCTACGTTCCCCGCCGATGG
GCTGGCGCCCAGCATCTGACAAAGAAGCTCCTCTTCCTCATGCTCATCTTTGCCATCAACGTCGGGCCCGGGGTC
AAGGTCTTTGTGATCCCTACGAAGAAGGACAAGGTCGACATCGACCTCATTATTGGCATCGTGCACTTTGTCATT
GCCGTCATCACCTTCCTCTTCTTCGCCGTTATGCCGCTCGGTGGACTGTTTGGCAGCTACCTCACCAAGAACTCG
AGACGTTATGTCGCCAGCCAGACCTTCACGGCCAGCTATCCTAAACTATCTGGCAACGACATGGCCATGTCGTAC
GGCCTGTGGCTGACCGTGTTTGGCGCCAAATTTGGCGAGTCCTACGTCTACCTCACGCTCTCTTTCCGAGATGTG
ATCCGCTATCTTTCCATCTTCCACCCCAGGTGCCAGGGCGATCACATGTTCGGCGCGGCTGCCACCATCCTCTGC
AAGAATCACCCGGCCATACTACTCGGCTTGATGGCGTTCACGGACCTCATCTTCTTCTTCCTCGATACCTACCTC
TTCTACGTCCTCCTCAACACCATCTTCTCTATTGCTCGGTCTTTCTACATCGGATCTTCCATTTGGACCCCGTGG
AGGAACATCTTCTCCCGCCTTCCGAAGAGGATCTACTCCAAAGTCCTGGCCACGACCGACATGGAGATCAAGTAC
AAGCCCAAGGTGCTGATATCGCAGGTCTGGAATGCTATCGTCATCTCCATGTATCGCGAGCATCTCCTGGCCATC
GACCACGTCCAGAAGCTGCTGTATCACCAGGTGCCGTCCGAGCAAGAGGGGAAGCGCACCCTGCGCGCTCCGACC
TTTTTCGTCTCTCAGGAAGACCATTCGTTCAAGACGGAGTTTTTCCCCAGCCATAGTGAGGCAGAGCGCCGCATC
TCCTTCTTCGCCCAGTCGCTGTCGACCCCCATCCCGGAGCCTCTTCCGGTGGATAACATGCCGACGTTCACGGTC
ATGATTCCTCACTACAGCGAGAAGATCCTGCTGTCCCTGCGCGAAATCATCCGCGAGGATGAACCGTATTCTCGA
GTGACCCTCTTGGAGTACCTCAAACAGCTGCACCCCCACGAGTGGGACTGCTTCGTCAAGGACACCAAGATCCTG
GCCGACGAGACGTCGCAGATGAATGGCGAATTCGAGAAGAGCGAGAAGGACGCCGCAAAGAGCAAGATTGACGAC
CTTCCCTTCTACTGCATCGGCTTCAAGTCCTCGGCTCCCGAGTACACCCTGCGGACTCGAATCTGGGCCTCGCTT
CGTTCTCAGACCCTGTACCGTACAGTCTCGGGCTTCATGAACTACAGCCGTGCCATCAAGCTCTTGTACCGAGTG
GAGAACCCGGAGGTAGTCCAGATGTTTGGCGGCAACTCCGACAAGCTCGAACGGGAACTGGAACGCATGGCTCGC
CGAAAGTTCAAGATTGTCGTTTCGATGCAGCGCTACTCCAAGTTCAAGAAGGAGGAGATGGAAAATGCCGAATTC
CTGCTTCGCGCGTATCCCGATTTGCAGATTGCCTATCTCGACGAGGAGCCTCCTGTTGCCGAGGGTGAGGAGCCC
CGGCTATACTCGGCTCTGATCGACGGCCACTCGGAGCTCATGGAGAACGGCATGCGACGACCAAAGTTCAGGATC
CAGCTCTCCGGCAACCCTGTTCTCGGTGACGGCAAATCGGACAACCAGAACCACTCTCTCATCTTCTACCGCGGC
GAATACATCCAACTCATCGATGCGAACCAGGACAACTACCTCGAGGAGTGCCTCAAGATCCGCAGCGTGCTGGCC
GAGTTTGAAGAGATGAAGACGGAGAACGTATCCCCATATACTCCAGGTGTCAAGAACGAGGTCTCCGCTCCGGTC
GCGATTCTTGGAGCCCGCGAGTACATCTTCTCCGAGAACATCGGCATCTTGGGAGACGTCGCCGCCGGTAAGGAA
CAGACGTTCGGAACGCTGTTTGCTCGTACCCTTGCGCAGATTGGAGGCAAGCTGCACTATGGTCACCCTGATTTC
CTCAACGGCATCTTCATGACGACTCGTGGCGGCGTGTCCAAGGCGCAGAAGGGCTTGCATCTCAACGAGGACATT
TTCGCCGGCATGAACGCCATCCTCCGCGGCGGGCGCATCAAGCATTGTGAATACTACCAGTGCGGCAAGGGTCGT
GATCTTGGTTTCGGCTCCATTCTCAACTTCACGACCAAGATTGGAACCGGCATGGGAGAACAGATGCTCTCTCGA
GAGTACTACTACCTAGGCACACAGCTTCCTCTTGACCGATTCCTATCCTTCTACTACGCCCATCCCGGTTTCCAC
ATCAACAACATGTTCATCATGCTCTCTGTCCAGCTCTTCATGCTCACGCTGCTCAATTTCGGCGCCTTCAAACAC
GAGACGATTGCCTGCGACTACAACCGGAACAAGCCGCTGACGGACCCCCTCTTCCCCACGGGATGCGCCAACACG
GACGCCGTCATGGACTGGGTTCAGCGCAGCATCTTCTCCATCTTCTTCGTCTTCTTCCTGTCGTTCGTGCCGCTC
ATCGTCCAGGAACTGACGGAACGTGGCGTGTGGCGCGCCCTGGTCCGCTTCCTGAAGCAGTTCTTCTCGCTCTCG
CCATTCTTCGAGGTGTTTGTCTGCCAGATTTACGCGAACTCTGTGCAGCAGGATCTTTCGTTTGGCGGTGCGCGA
TACATCGGAACCGGGCGTGGTTTCGCCACGGCGCGTATCCCCTTTGGCGTCTTGTACTCGCGCTTCGCCGGGCCG
TCGATCTACTTTGGCGCCAGGCTCTTGATGATTCTCCTCTTCGCCACGGTCACGGCCTGGCAGGCGGCTCTGACG
TATTTCTGGATCACGCTGCTCGGCCTCACCATCTCGCCGTTCCTTTACAATCCGCATCAATTCGCCTGGAACGAC
TTCTTCATCGACTATCGGGATTTCTTGCGCTGGCTCTCCAGAGGCAACTCGCGGAGCCACGCGTCGTCGTGGATC
GCCTTTTGCCGTCTTTCGCGGACTCGGATCACGGGTTACAAGCGCAAGGCCCTGGGCGAGGCCTCGGCCAAGATG
TCGGCCGATGTCCCGCGCGCTGCCATTGCCAACATTTTCTTCACGGAGATCCTGACGCCCCTTATGCAGGTCGTT
TGGACCCTGATTCCATACTTGTTCATCAATGCGCAGACGGGTGTCTTGAGCGCCAAGAACAAGGACGCCGACATC
AAGCCCACGGACTCTCTGATCCGCGTCCTCGTCGTCGCCTTGGCACCCATAGGCATCAACGCCGGAGTCCTCGGG
GCCATGTTCGCCATGGCTTGCTTCATGGGCCCTGTCCTCAGCATGTGCTGCAAGAAGTTCGGCAGCGTCCTGGCG
GCCATTGCCCACGGCGCGGCTGCCGTCTTCATGCTCATCTTCTTCGAGGCCATGTTCGTTCTTGAGGGCTTCAAT
TTTGCCAGGACCCTCGCCGGAATGATTGCCGTCGTGGCCATCCAGAGGTTCATCTTCAAGCTCATCGTCTCTCTC
GCCTTGACTCGCGAGATGAAGACGGATCAGTCCAACGTCGCCTTCTGGACGGGCAAGTGGTACTCGATGGGCTGG
CATTCCGTGTCACAACCCGCGCGCGAGTTCCTGTGCAAGATTACGGAATTGAGCATGTTCGCGGCTGACTTCATC
CTGGGCCACTGGCTGCTGTTCCTGATGCTGCCCATCATCCTAATCCCGCAGGTCGACAAACTTCACTCGATGATG
CTCTTCTGGCTGAGACCCAGTCGACAAATTCGGCCTCCGATTTACTCGATGAAACAGTCCAAGCTGAGGCGGCGC
AGAGTGGTTCGATATGCCATGCTCTACTTTGTGCTCTTGGCCGTCTTCCTTGGACTGATTGTTGGTCCCATCTTG
GCCGGCGACAAGATACCTCCCAAGATTCTCAGGCAAATCGGCGACCAGACGTCTCTGTCGCACAAGTTCCGTCTC
ATGCAGCCAAACGCCCAAGACAAGGACAACACGAACGGCACCGAGGAAACGGGGACTGGCAGACCGGGCTACAGC
GGTGCCTTTACCAAGTCGACAACCAGAACGGGGGCCGCTGAACCGACGGGTGGCGGCGGCGGCGGCGGCGGTGGT
GGAGGAGGAGGAGGAACAATAGGATAA
Gene >Ophcf2|01782
ATGCGGACACGACGTTTTATACATACGCAGCCAGGTTCTTACCGAGCACAGCGGATACAGTACATATATACATAA
ATATTCATGTACGAAGTATTTGTAGGTACCTACAGGTATGTATTCACGAATACATGCCTACAGGCTACAGGCTAC
AGCTTACATGTAGGTACCTAGTTAGGTAAGTATGGATGTACTCTACATACCTATTTACAAACGTGTCCCCTGCTC
ATGCGCCTATTGTTCGGCTGGCCACTACTTTCCCACGTCTGACCTCAGGTTCGGCCTATCAGACTCGGCCGGACA
TGGCTAGAGTCAGGGGGGAAAGGGGCAAAGGGGGGAGGGCGCAGGCGTCTTCCCGGGCGCTTGAACGAAGCGTGC
AAGGATCAAGTCCGCCCTCCTATTTCGTACATAGGTACTTCGCGAACTCAGCTGGTACATACCTAGATACCTACC
TCCCGCAACTGCCTCTCAGGACATGGCAGCGTCCCGCTTTATCCCGCGCATCTTGTGTCGAACCTGAAAGCTGCG
TGTAACTGTACCTAGATAGGTACCTACCTCAGGTATCTACTTGCTTACATGCTGTGTGTACCGACATGGAAGTAC
TTCGATCTATGCCTTGTATGTACTCAATACCTGCTGAATATCCGCCCACCACCGTTCGTAGAGGTGCTTGCAGGT
TCCCGCGACTCTCTCTCCGTCACTCAGCCACCTCTGCTCACCGCAGCAGCGCTGCTGTCCTTCCCTCTCCCGCTG
GAAGCTCCACCCCCCTTTGGATTCCATCCTCTCCGTTCTCCCTTTACGACTTCCTCCCCCTCTGATTCTCTTTTT
TCCCCCCGTAGGCCTTCAGGGGAGACGGCGACTGCGACCTCAATCGCGTCTTCACGACGGCTTGAGTCCGACACT
CGCTACCTACCTATTCCTTCTGCTTGCTGTTCTTTCCAGCACTCGCCCGGTCGTTACTGTCGCGACCTCTCTTGG
CTGACGGTCGACCTTCTGTTTGTTCTTCCCGTCAGCTCCCCACGACTACGAGCACCGCATCTCGCACTCCACCCT
TCGTTGGTCCCGCTCGACTTCGGCTCGTGACGCGGTCGCTTTGGTTTGGCAGTGAGTGCTGTGATTCGCCGACTT
TGGCGCAACACCTCCCAGCCGCCTCGATTACGCGGACACCCGCAGCGAGCGCCAGATCAACACGCCCTGAACACT
TTCGCCTCTTGCCCTGCTTCGTCTTGATACCGCCGCCATCCCCAGCCTCTACGCGGTTCGATGTGTGTCGAAGAG
TTTGTGTCCTTGCTTTCCTTTCTCATTCTCCCGCTTCTCTCCTCTGGCTTACGCGGATTCCTCAACCATACAGTT
AATCCTCTGTCAAAATGTCGGGGTATCCAGGCGGTCATCACGACCACTACGACGACGGCTATGGTCACCAAGGCG
GCCATACCGATTCGTACTATCAAGATGACCAATATTACGACAACGGCTACGACGCTCGAGGCGGCCAAGGAGCCC
ACGGCAATGCTGGCGACGGCTACTACGACGAATCGTTCGTCCCCCCCCCCCAATTGTGCTTGCACAAAGCTCATC
TCGTCGTTAACCCGGGCTACAGGGGATACTACAATGCCGATCCCAACAACCCATATCACCAGGATGGAGGATACT
ATGATGGCCACGACCAGTATCAGGACGACTATTACAACGGCCAGGGCGGCGGCTACTACGACAACGAGTACAACA
ACGGGTACGCTGCCAACAGCGGTCGGCACGGTTCTGAAGAGGACTCGGAGACCTTTAGCGACTTCACCATGAGGT
CTGACATGGCCCGAGCCGCTGAGATGGACTATTACGGGCGCGGCGATGAGCGCCATAACAGTTACGGTGATGGGC
AGCGAGGGTATCGCCCGCCCTCCTCGCAGCTGTCGTACGGCGCGAATCGCTCGTCTGGCGCGTCCACTCCCAACT
ATGGCATGGACTACGGCAACGTGCTGCCAGCTGGCCAACGATCCCGGGAGCCGTACCCTGCCTGGACTTCGGACG
CACAGATTCCCCTCTCCAAGGAGGAAATCGAGGATATCTTTATGGACTTGACTGCAAAGTTTGGCTTCCAGCGAG
ACAGCATGCGCAACATGTATGACCACCTCATGACGCTGCTCGACTCCAGAGCTTCTCGCATGACGCCCAACCAAG
CACTGCTGTCCCTCCACGCCGATTACATTGGTGGAGACAACGCCAACTATCGGAAGTGGTATTTCGCCGCCCACC
TTGATCTGGACGACGCCGTCGGCTTCGCCAACGCAAAGAGCAAGGGCCTGCGTCGGAAGGCCAAGAACAAGAAGA
AGAAGGCGGGTGATGCCGCCAACGAAGACGAGGCTCTGCAGGATCTTGAGGGCGACAACAGCTTGGAAGCGGCCG
AATACCGCTGGAAGACTCGGATGAATCGCATGTCGCAGCATGATCGTGTGCGCCAGATCGCACTCTACCTCCTCT
GCTGGGGCGAAGCAAATCAAGTCCGATTCATGCCCGAGTGTCTCTGCTTCGTCTTCAAATGCGCCGACGACTACC
TCAACTCGCCCGCCTGCCAGGCCCTCGTGGAGCCTGTCGACGAGTTCACGTACCTGAACAACGTCATCACTCCCC
TTTACCAGTACTGCCGCAACCAGGGCTACGAGATCCTTAACGGGGTCTACGTTCGCCGCGAGCGCGACCACAAGC
ACATCATCGGTTATGACGACTGCAACCAGCTGTTCTGGTACCCTGAAGGCATCGAGCGCATCGTCCTGCAGGATA
AGAGCAAGCTGGTCGACGTTCCGCCTGCTGAGCGATACCTGAAGCTCAAGGACGTCGAATGGAAGAAGTGCTTCT
TCAAGACGTACAAGGAGACGCGGTCCTGGGGTCACCTCTTGGTCAACTTCAACCGCATCTGGATCATTCATCTTA
CCATGTTCTGGTTCTACACGGCACACAACGCGCCCACCCTCATCGTCGGCAACGCGTACGAGCAGCAGGTTAACA
ACCAGCCGCCCGCGTCGAAGCAATTTTCCGTCGTCGCGTTCGGCGGTGCCATTGCCGCCTTCATCCAGATTCTGG
CGACCTTGGCCGAATGGGCCTACGTTCCCCGCCGATGGGCTGGCGCCCAGCATCTGACAAAGAAGCTCCTCTTCC
TCATGCTCATCTTTGCCATCAACGTCGGGCCCGGGGTCAAGGTCTTTGTGATCCCTACGAAGAAGGACAAGGTCG
ACATCGACCTCATTATTGGCATCGTGCACTTTGTCATTGCCGTCATCACCTTCCTCTTCTTCGCCGTTATGCCGC
TCGGTGGACTGTTTGGCAGCTACCTCACCAAGAACTCGAGACGTTATGTCGCCAGCCAGACCTTCACGGCCAGCT
ATCCTAAACTATCTGGCAACGACATGGCCATGTCGTACGGCCTGTGGCTGACCGTGTTTGGCGCCAAATTTGGCG
AGTCCTACGTCTACCTCACGCTCTCTTTCCGAGATGTGATCCGCTATCTTTCCATCTTCCACCCCAGGTGCCAGG
GCGATCACATGTTCGGCGCGGCTGCCACCATCCTCTGCAAGAATCACCCGGCCATACTACTCGGCTTGATGGCGT
TCACGGACCTCATCTTCTTCTTCCTCGATACCTACCTCTTCTACGTCCTCCTCAACACCATCTTCTCTATTGCTC
GGTCTTTCTACATCGGATCTTCCATTTGGACCCCGTGGAGGAACATCTTCTCCCGCCTTCCGAAGAGGATCTACT
CCAAAGTCCTGGCCACGACCGACATGGAGATCAAGTACAAGCCCAAGGTGCTGATATCGCAGGTCTGGAATGCTA
TCGTCATCTCCATGTATCGCGAGCATCTCCTGGCCATCGACCACGTCCAGAAGCTGCTGTATCACCAGGTGCCGT
CCGAGCAAGAGGGGAAGCGCACCCTGCGCGCTCCGACCTTTTTCGTCTCTCAGGAAGACCATTCGTTCAAGACGG
AGTTTTTCCCCAGCCATAGTGAGGCAGAGCGCCGCATCTCCTTCTTCGCCCAGTCGCTGTCGACCCCCATCCCGG
AGCCTCTTCCGGTGGATAACATGCCGACGTTCACGGTCATGATTCCTCACTACAGCGAGAAGATCCTGCTGTCCC
TGCGCGAAATCATCCGCGAGGATGAACCGTATTCTCGAGTGACCCTCTTGGAGTACCTCAAACAGCTGCACCCCC
ACGAGTGGGACTGCTTCGTCAAGGACACCAAGATCCTGGCCGACGAGACGTCGCAGATGAATGGCGAATTCGAGA
AGAGCGAGAAGGACGCCGCAAAGAGCAAGATTGACGACCTTCCCTTCTACTGCATCGGCTTCAAGTCCTCGGCTC
CCGAGTACACCCTGCGGACTCGAATCTGGGCCTCGCTTCGTTCTCAGACCCTGTACCGTACAGTCTCGGGCTTCA
TGAACTACAGCCGTGCCATCAAGCTCTTGTACCGAGTGGAGAACCCGGAGGTAGTCCAGATGTTTGGCGGCAACT
CCGACAAGCTCGAACGGGAACTGGAACGCATGGCTCGCCGAAAGTTCAAGATTGTCGTTTCGATGCAGCGCTACT
CCAAGTTCAAGAAGGAGGAGATGGAAAATGCCGAATTCCTGCTTCGCGCGTATCCCGATTTGCAGATTGCCTATC
TCGACGAGGAGCCTCCTGTTGCCGAGGGTGAGGAGCCCCGGCTATACTCGGCTCTGATCGACGGCCACTCGGAGC
TCATGGAGAACGGCATGCGACGACCAAAGTTCAGGATCCAGCTCTCCGGCAACCCTGTTCTCGGTGACGGCAAAT
CGGACAACCAGAACCACTCTCTCATCTTCTACCGCGGCGAATACATCCAACTCATCGATGCGAACCAGGACAACT
ACCTCGAGGAGTGCCTCAAGATCCGCAGCGTGCTGGCCGAGTTTGAAGAGATGAAGACGGAGAACGTATCCCCAT
ATACTCCAGGTGTCAAGAACGAGGTCTCCGCTCCGGTCGCGATTCTTGGAGCCCGCGAGTACATCTTCTCCGAGA
ACATCGGCATCTTGGGAGACGTCGCCGCCGGTAAGGAACAGACGTTCGGAACGCTGTTTGCTCGTACCCTTGCGC
AGATTGGAGGCAAGCTGCACTATGGTCACCCTGATTTCCTCAACGGCATCTTCATGACGACTCGTGGCGGCGTGT
CCAAGGCGCAGAAGGGCTTGCATCTCAACGAGGACATTTTCGCCGGCATGAACGCCATCCTCCGCGGCGGGCGCA
TCAAGCATTGTGAATACTACCAGTGCGGCAAGGGTCGTGATCTTGGTTTCGGCTCCATTCTCAACTTCACGACCA
AGATTGGAACCGGCATGGGAGAACAGATGCTCTCTCGAGAGTACTACTACCTAGGCACACAGCTTCCTCTTGACC
GATTCCTATCCTTCTACTACGCCCATCCCGGTTTCCACATCAACAACATGTTCATCATGCTCTCTGTCCAGCTCT
TCATGCTCACGCTGCTCAATTTCGGCGCCTTCAAACACGAGACGATTGCCTGCGACTACAACCGGAACAAGCCGC
TGACGGACCCCCTCTTCCCCACGGGATGCGCCAACACGGACGCCGTCATGGACTGGGTTCAGCGCAGCATCTTCT
CCATCTTCTTCGTCTTCTTCCTGTCGTTCGTGCCGCTCATCGTCCAGGAACTGACGGAACGTGGCGTGTGGCGCG
CCCTGGTCCGCTTCCTGAAGCAGTTCTTCTCGCTCTCGCCATTCTTCGAGGTGTTTGTCTGCCAGATTTACGCGA
ACTCTGTGCAGCAGGATCTTTCGTTTGGCGGTGCGCGATACATCGGAACCGGGCGTGGTTTCGCCACGGCGCGTA
TCCCCTTTGGCGTCTTGTACTCGCGCTTCGCCGGGCCGTCGATCTACTTTGGCGCCAGGCTCTTGATGATTCTCC
TCTTCGCCACGGTCACGGCCTGGCAGGCGGCTCTGACGTATTTCTGGATCACGCTGCTCGGCCTCACCATCTCGC
CGTTCCTTTACAATCCGCATCAATTCGCCTGGAACGACTTCTTCATCGACTATCGGGATTTCTTGCGCTGGCTCT
CCAGAGGCAACTCGCGGAGCCACGCGTCGTCGTGGATCGCCTTTTGCCGTCTTTCGCGGACTCGGATCACGGGTT
ACAAGCGCAAGGCCCTGGGCGAGGCCTCGGCCAAGATGTCGGCCGATGTCCCGCGCGCTGCCATTGCCAACATTT
TCTTCACGGAGATCCTGACGCCCCTTATGCAGGTCGTTTGGACCCTGATTCCATACTTGTTCATCAATGCGCAGA
CGGGTGTCTTGAGCGCCAAGAACAAGGACGCCGACATCAAGCCCACGGACTCTCTGATCCGCGTCCTCGTCGTCG
CCTTGGCACCCATAGGCATCAACGCCGGAGTCCTCGGGGCCATGTTCGCCATGGCTTGCTTCATGGGCCCTGTCC
TCAGCATGTGCTGCAAGAAGTTCGGCAGCGTCCTGGCGGCCATTGCCCACGGCGCGGCTGCCGTCTTCATGCTCA
TCTTCTTCGAGGCCATGTTCGTTCTTGAGGGCTTCAATTTTGCCAGGACCCTCGCCGGAATGATTGCCGTCGTGG
CCATCCAGAGGTTCATCTTCAAGCTCATCGTCTCTCTCGCCTTGACTCGCGAGATGAAGACGGATCAGTCCAACG
TCGCCTTCTGGACGGGCAAGTGGTACTCGATGGGCTGGCATTCCGTGTCACAACCCGCGCGCGAGTTCCTGTGCA
AGATTACGGAATTGAGCATGTTCGCGGCTGACTTCATCCTGGGCCACTGGCTGCTGTTCCTGATGCTGCCCATCA
TCCTAATCCCGCAGGTCGACAAACTTCACTCGATGATGCTCTTCTGGCTGAGACCCAGGTATGTTGTTTTGAGAA
GAAACGAAATCGCAGGTGGGCAGTTGCTAACAGAAGATGCAGTCGACAAATTCGGCCTCCGATTTACTCGATGAA
ACAGTCCAAGCTGAGGCGGCGCAGAGTGGTTCGATATGCCATGCTCTACTTTGTGCTCTTGGCCGTCTTCCTTGG
ACTGATTGTTGGTCCCATCTTGGCCGGCGACAAGATACCTCCCAAGATTCTCAGGCAAATCGGCGACCAGACGTC
TCTGTCGCACAAGTTCCGTCTCATGCAGCCAAACGCCCAAGACAAGGACAACACGAACGGCACCGAGGAAACGGG
GACTGGCAGACCGGGCTACAGCGGTGCCTTTACCAAGTCGACAACCAGAACGGGGGCCGCTGAACCGACGGGTGG
CGGCGGCGGCGGCGGCGGTGGTGGAGGAGGAGGAGGAACAATAGGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail