Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01778
Gene name
Locationscaffold_02:435202..437250
Strand+
Gene length (bp)2048
Transcript length (bp)1911
Coding sequence length (bp)1911
Protein length (aa) 637

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00650 CRAL_TRIO CRAL/TRIO domain 2.1E-44 365 510
PF03765 CRAL_TRIO_N CRAL/TRIO, N-terminal domain 1.1E-14 268 318
PF13716 CRAL_TRIO_2 Divergent CRAL/TRIO domain 1.6E-07 378 508

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 56 0.45

Transmembrane Domains

Domain # Start End Length
1 133 155 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01778
MSARSVRLTAQLQTRTTRTTKTRTRIKTTTKTKTKTTTTSAAATAAATAATTALASPLFPRQSSPGSCHFLDTTL
RHGIRSLIDTPTVRPVPPPRLITPSIAVRLLSQTRPCSSEPRLSCPPRQPLVVLKSSLSSLCSSFVAVALLAFAT
WVMLAPNSPDSPLSSAVQDMSINVEADAPGHIGNLTPEQEEKLRRLWIAIAKLCAVDGSDAADSRAESPPTAEEP
DQSQKRRFSLFRRKQAESPTSVAVNIDDTKEGADDGDKYGQTKQFLKTLASQTPETIRETIWSMVKQDHPDALVL
RFLRARKWDVDRALVMLISAMNWRFSDMRVDNDIMHKGESGAIEDEINGDEVDKKLGTDFIYQCRAGKCFLHGTD
KQGRPICVVRVRLHKPSAQSAESLERFTVYVIETARLVLQAPVSTATIVFDMTGFSLANMDYHPVKFMIQCFEAN
YPECLGAILVHNAPWVFQGIWRIIRGWLDPVVAAKVHFTNYRAGLEEYIDPNHIIKDLDGDEDWEFKYEEPVPGE
NDKMKDTRTRDQLLAARDVLYGKFEQETMNWIRSPSSDEGKKAKAARDRIAEKLHAGYWELDPYVRSRSYYDRTG
VLQPGGIVNWYQKEEGAKTNGNGVRNGSNASQASTE*
Coding >Ophcf2|01778
ATGAGCGCCCGCTCTGTTCGCCTTACTGCCCAGCTTCAGACGAGGACGACGAGGACGACGAAGACGAGGACGAGA
ATCAAGACGACGACCAAGACCAAGACCAAGACGACGACAACGTCAGCTGCTGCTACCGCTGCTGCTACCGCTGCT
ACTACCGCTCTTGCTTCGCCCCTGTTTCCGCGTCAATCCTCCCCCGGGTCCTGCCATTTCCTCGATACCACTCTC
CGCCACGGCATCAGATCGCTCATTGATACTCCGACCGTCCGTCCCGTCCCGCCCCCTCGCCTGATCACGCCCTCG
ATCGCCGTCCGGCTCCTCAGCCAGACACGGCCCTGCTCTTCCGAGCCGCGGCTTTCGTGCCCCCCTCGTCAGCCC
CTCGTCGTCCTCAAAAGCTCGCTCTCCTCCCTCTGTTCCTCCTTCGTTGCCGTCGCTCTCTTGGCTTTCGCCACC
TGGGTCATGTTGGCCCCCAATTCTCCCGATTCCCCCCTCTCCTCCGCCGTTCAAGACATGTCTATCAACGTCGAG
GCCGACGCCCCCGGCCACATCGGCAACCTGACACCCGAGCAGGAGGAGAAGCTGCGCAGGCTGTGGATCGCCATC
GCCAAGCTGTGTGCTGTGGATGGCTCCGATGCTGCTGATAGCCGTGCCGAGTCGCCACCCACGGCAGAGGAGCCT
GATCAGTCTCAGAAAAGGCGCTTCAGTCTCTTCCGGCGCAAGCAGGCTGAGAGTCCGACATCGGTCGCCGTCAAT
ATAGACGATACCAAGGAAGGTGCCGACGATGGCGACAAGTACGGTCAGACGAAGCAGTTCCTCAAGACGCTCGCC
AGCCAGACGCCCGAGACCATCCGCGAGACCATCTGGTCCATGGTCAAGCAAGACCACCCGGACGCGCTCGTCTTG
CGGTTCCTGCGTGCCCGAAAGTGGGATGTCGACAGGGCGCTCGTCATGCTAATCTCCGCCATGAACTGGCGGTTC
AGCGACATGCGCGTCGATAACGACATCATGCACAAGGGCGAGAGCGGCGCCATTGAGGACGAGATCAACGGCGAC
GAAGTCGACAAGAAGCTCGGCACCGACTTCATCTATCAATGTCGCGCTGGCAAATGCTTCCTGCACGGCACGGAT
AAGCAAGGACGCCCCATCTGCGTCGTCCGCGTCCGGCTGCACAAGCCGAGCGCTCAATCGGCCGAGAGCCTGGAG
CGTTTCACAGTCTACGTCATCGAAACTGCCCGTCTCGTGCTCCAGGCTCCTGTCTCTACAGCGACCATCGTTTTC
GACATGACTGGCTTCTCCCTGGCTAACATGGACTATCATCCCGTCAAGTTCATGATCCAATGCTTCGAGGCAAAC
TATCCCGAGTGTCTGGGCGCCATATTAGTCCACAACGCGCCATGGGTGTTCCAAGGCATCTGGCGAATCATTCGC
GGCTGGCTCGACCCCGTCGTGGCCGCCAAGGTCCACTTCACCAACTACAGAGCCGGATTGGAAGAGTACATCGAC
CCGAACCACATCATCAAGGACCTCGACGGCGACGAAGACTGGGAGTTCAAGTACGAGGAGCCCGTGCCGGGAGAG
AACGACAAGATGAAGGATACGCGGACCAGGGACCAGCTCCTCGCGGCCAGAGATGTGCTGTACGGCAAGTTTGAG
CAAGAGACGATGAACTGGATCCGCTCTCCCTCTTCGGACGAGGGCAAGAAGGCCAAGGCCGCGCGAGACAGGATC
GCCGAGAAGCTGCACGCAGGCTACTGGGAACTCGACCCTTACGTGCGCTCTCGGTCTTACTACGACAGAACAGGT
GTCCTACAACCTGGAGGCATCGTCAATTGGTATCAGAAAGAGGAGGGGGCCAAGACCAACGGGAACGGCGTTCGC
AATGGGAGTAATGCGTCGCAGGCGTCAACGGAATAA
Transcript >Ophcf2|01778
ATGAGCGCCCGCTCTGTTCGCCTTACTGCCCAGCTTCAGACGAGGACGACGAGGACGACGAAGACGAGGACGAGA
ATCAAGACGACGACCAAGACCAAGACCAAGACGACGACAACGTCAGCTGCTGCTACCGCTGCTGCTACCGCTGCT
ACTACCGCTCTTGCTTCGCCCCTGTTTCCGCGTCAATCCTCCCCCGGGTCCTGCCATTTCCTCGATACCACTCTC
CGCCACGGCATCAGATCGCTCATTGATACTCCGACCGTCCGTCCCGTCCCGCCCCCTCGCCTGATCACGCCCTCG
ATCGCCGTCCGGCTCCTCAGCCAGACACGGCCCTGCTCTTCCGAGCCGCGGCTTTCGTGCCCCCCTCGTCAGCCC
CTCGTCGTCCTCAAAAGCTCGCTCTCCTCCCTCTGTTCCTCCTTCGTTGCCGTCGCTCTCTTGGCTTTCGCCACC
TGGGTCATGTTGGCCCCCAATTCTCCCGATTCCCCCCTCTCCTCCGCCGTTCAAGACATGTCTATCAACGTCGAG
GCCGACGCCCCCGGCCACATCGGCAACCTGACACCCGAGCAGGAGGAGAAGCTGCGCAGGCTGTGGATCGCCATC
GCCAAGCTGTGTGCTGTGGATGGCTCCGATGCTGCTGATAGCCGTGCCGAGTCGCCACCCACGGCAGAGGAGCCT
GATCAGTCTCAGAAAAGGCGCTTCAGTCTCTTCCGGCGCAAGCAGGCTGAGAGTCCGACATCGGTCGCCGTCAAT
ATAGACGATACCAAGGAAGGTGCCGACGATGGCGACAAGTACGGTCAGACGAAGCAGTTCCTCAAGACGCTCGCC
AGCCAGACGCCCGAGACCATCCGCGAGACCATCTGGTCCATGGTCAAGCAAGACCACCCGGACGCGCTCGTCTTG
CGGTTCCTGCGTGCCCGAAAGTGGGATGTCGACAGGGCGCTCGTCATGCTAATCTCCGCCATGAACTGGCGGTTC
AGCGACATGCGCGTCGATAACGACATCATGCACAAGGGCGAGAGCGGCGCCATTGAGGACGAGATCAACGGCGAC
GAAGTCGACAAGAAGCTCGGCACCGACTTCATCTATCAATGTCGCGCTGGCAAATGCTTCCTGCACGGCACGGAT
AAGCAAGGACGCCCCATCTGCGTCGTCCGCGTCCGGCTGCACAAGCCGAGCGCTCAATCGGCCGAGAGCCTGGAG
CGTTTCACAGTCTACGTCATCGAAACTGCCCGTCTCGTGCTCCAGGCTCCTGTCTCTACAGCGACCATCGTTTTC
GACATGACTGGCTTCTCCCTGGCTAACATGGACTATCATCCCGTCAAGTTCATGATCCAATGCTTCGAGGCAAAC
TATCCCGAGTGTCTGGGCGCCATATTAGTCCACAACGCGCCATGGGTGTTCCAAGGCATCTGGCGAATCATTCGC
GGCTGGCTCGACCCCGTCGTGGCCGCCAAGGTCCACTTCACCAACTACAGAGCCGGATTGGAAGAGTACATCGAC
CCGAACCACATCATCAAGGACCTCGACGGCGACGAAGACTGGGAGTTCAAGTACGAGGAGCCCGTGCCGGGAGAG
AACGACAAGATGAAGGATACGCGGACCAGGGACCAGCTCCTCGCGGCCAGAGATGTGCTGTACGGCAAGTTTGAG
CAAGAGACGATGAACTGGATCCGCTCTCCCTCTTCGGACGAGGGCAAGAAGGCCAAGGCCGCGCGAGACAGGATC
GCCGAGAAGCTGCACGCAGGCTACTGGGAACTCGACCCTTACGTGCGCTCTCGGTCTTACTACGACAGAACAGGT
GTCCTACAACCTGGAGGCATCGTCAATTGGTATCAGAAAGAGGAGGGGGCCAAGACCAACGGGAACGGCGTTCGC
AATGGGAGTAATGCGTCGCAGGCGTCAACGGAATAA
Gene >Ophcf2|01778
ATGAGCGCCCGCTCTGTTCGCCTTACTGCCCAGCTTCAGACGAGGACGACGAGGACGACGAAGACGAGGACGAGA
ATCAAGACGACGACCAAGACCAAGACCAAGACGACGACAACGTCAGCTGCTGCTACCGCTGCTGCTACCGCTGCT
ACTACCGCTCTTGCTTCGCCCCTGTTTCCGCGTCAATCCTCCCCCGGGTCCTGCCATTTCCTCGATACCACTCTC
CGCCACGGCATCAGATCGCTCATTGATACTCCGACCGTCCGTCCCGTCCCGCCCCCTCGCCTGATCACGCCCTCG
ATCGCCGTCCGGCTCCTCAGCCAGACACGGCCCTGCTCTTCCGAGCCGCGGCTTTCGTGCCCCCCTCGTCAGCCC
CTCGTCGTCCTCAAAAGCTCGCTCTCCTCCCTCTGTTCCTCCTTCGTTGCCGTCGCTCTCTTGGCTTTCGCCACC
TGGGTCATGTTGGCCCCCAATTCTCCCGATTCCCCCCTCTCCTCCGCCGTTCAAGACATGTCTATCAACGTCGAG
GCCGACGCCCCCGGCCACATCGGCAACCTGACACCCGAGCAGGAGGAGAAGCTGCGCAGGCTGTGGATCGCCATC
GCCAAGCTGTGTGCTGTGGATGGCTCCGATGCTGCTGATAGCCGTGCCGAGTCGCCACCCACGGCAGAGGAGCCT
GATCAGTCTCAGAAAAGGCGCTTCAGTCTCTTCCGGCGCAAGCAGGCTGAGAGTCCGACATCGGTCGCCGTCAAT
ATAGACGATACCAAGGAAGGTGCCGACGATGGCGACAAGTACGGTCAGACGAAGCAGTTCCTCAAGACGCTCGCC
AGCCAGACGCCCGAGACCATCCGCGAGACCATCTGGTCCATGGTCAAGCAAGACCACCCGGACGCGCTCGTCTTG
CGGTTCCTGCGTGCCCGAAAGTGGGATGTCGACAGGGCGCTCGTCATGCTAATCTCCGCCATGAACTGGCGGTTC
AGCGACATGCGCGTCGATAACGACATCATGCACAAGGGCGAGAGCGGCGCCATTGAGGACGAGATCAACGGCGAC
GAAGTCGACAAGAAGCTCGGCACCGACTTCATCTATCAATGTCGCGCTGGCAAATGCTTCCTGCACGGCACGGAT
AAGCAAGGACGCCCCATCTGCGTCGTCCGCGTCCGGCTGCACAAGCCGAGCGCTCAATCGGCCGAGAGCCTGGAG
CGTTTCACAGTCTACGTCATCGAAACTGCCCGTCTCGTGCTCCAGGCTCCTGTCTCTACAGCGGTTGGCTCACCC
CCCCCTCCACACTCCCTCAGAGACGAGAACCAACAGCTGACGATGGCTCCTCGCACAACCCTAGACCATCGTTTT
CGACATGACTGGCTTCTCCCTGGCTAACATGGACTATCATCCCGTCAAGTTCATGATCCAATGCTTCGAGGCAAA
CTATCCCGAGTGTCTGGGCGCCATATTAGTCCACAACGCGCCATGGGTGTTCCAAGGTTCGCCGTTACCCGGCAG
CTTGGGAAGAGAGACGAGCGTGTTAAGCTAACGAGCGATCAGGCATCTGGCGAATCATTCGCGGCTGGCTCGACC
CCGTCGTGGCCGCCAAGGTCCACTTCACCAACTACAGAGCCGGATTGGAAGAGTACATCGACCCGAACCACATCA
TCAAGGACCTCGACGGCGACGAAGACTGGGAGTTCAAGTACGAGGAGCCCGTGCCGGGAGAGAACGACAAGATGA
AGGATACGCGGACCAGGGACCAGCTCCTCGCGGCCAGAGATGTGCTGTACGGCAAGTTTGAGCAAGAGACGATGA
ACTGGATCCGCTCTCCCTCTTCGGACGAGGGCAAGAAGGCCAAGGCCGCGCGAGACAGGATCGCCGAGAAGCTGC
ACGCAGGCTACTGGGAACTCGACCCTTACGTGCGCTCTCGGTCTTACTACGACAGAACAGGTGTCCTACAACCTG
GAGGCATCGTCAATTGGTATCAGAAAGAGGAGGGGGCCAAGACCAACGGGAACGGCGTTCGCAATGGGAGTAATG
CGTCGCAGGCGTCAACGGAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail