Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01776
Gene name
Locationscaffold_02:432404..432923
Strand+
Gene length (bp)519
Transcript length (bp)390
Coding sequence length (bp)390
Protein length (aa) 130

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12171 zf-C2H2_jaz Zinc-finger double-stranded RNA-binding 1.6E-07 50 75

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2917 0.7203 0.0312 0.0716 0.2155 0.006 0.1133 0.0171 0.043 0.0004

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6676
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|01776 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6348
Ophiocordyceps kimflemingae Ophio5|4976
Ophiocordyceps subramaniannii Hirsu2|5601

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01776
MGVGNKRTMTKTRRKSRDVDQIKADLVSPRHLSEYKDCKASEDLPGFGEHYCVECARWFDTALTLGSHRRGKPHK
RRIKQLREEPDPDPRRVVGALVSNSADGEGGGGAASTGMVWEPAADCASTTAFT*
Coding >Ophcf2|01776
ATGGGAGTCGGCAACAAGCGCACCATGACGAAAACGAGGCGGAAATCAAGGGATGTAGATCAGATAAAGGCGGAC
CTCGTCTCTCCGCGGCACCTCTCTGAGTACAAGGACTGCAAGGCTTCGGAAGATCTTCCGGGCTTTGGGGAGCAT
TATTGCGTTGAGTGTGCGAGGTGGTTCGATACCGCTTTGACGCTGGGTTCTCATCGACGGGGGAAGCCTCATAAG
CGAAGGATCAAGCAGTTGCGCGAGGAGCCTGATCCTGACCCTCGTCGTGTTGTGGGGGCGCTTGTTTCGAATTCG
GCTGATGGTGAGGGAGGGGGGGGCGCGGCTTCGACTGGCATGGTGTGGGAACCTGCTGCGGATTGCGCATCGACG
ACGGCTTTCACCTGA
Transcript >Ophcf2|01776
ATGGGAGTCGGCAACAAGCGCACCATGACGAAAACGAGGCGGAAATCAAGGGATGTAGATCAGATAAAGGCGGAC
CTCGTCTCTCCGCGGCACCTCTCTGAGTACAAGGACTGCAAGGCTTCGGAAGATCTTCCGGGCTTTGGGGAGCAT
TATTGCGTTGAGTGTGCGAGGTGGTTCGATACCGCTTTGACGCTGGGTTCTCATCGACGGGGGAAGCCTCATAAG
CGAAGGATCAAGCAGTTGCGCGAGGAGCCTGATCCTGACCCTCGTCGTGTTGTGGGGGCGCTTGTTTCGAATTCG
GCTGATGGTGAGGGAGGGGGGGGCGCGGCTTCGACTGGCATGGTGTGGGAACCTGCTGCGGATTGCGCATCGACG
ACGGCTTTCACCTGA
Gene >Ophcf2|01776
ATGGGAGTCGGCAACAAGCGCACCATGACGAAAACGAGGCGGAAATCAAGGTACTGCCGACTACGTCATCTCTCA
CGCGCGCGCCGCAACGGCAGGCAGGTCTGACGCGAATCCCTTAGGGATGTAGATCAGATAAAGGCGGACCTCGTC
TCTCCGCGGCACCTCTCTGAGTACAAGGACTGCAAGGCTTCGGAAGATCTTCCGGGCTTTGGGGAGCATTATTGC
GTTGAGTGTGCGAGGTGGTTCGATACCGCTTTGACGCTGGGTTCTCATCGACGGGGGAAGCCTCATAAGCGAAGG
TCTGTCTTTTTTGCGCGTGGCTATGCAAGTTTCGTTCCTGACGGTTGAGAGAAATACAGGATCAAGCAGTTGCGC
GAGGAGCCTGATCCTGACCCTCGTCGTGTTGTGGGGGCGCTTGTTTCGAATTCGGCTGATGGTGAGGGAGGGGGG
GGCGCGGCTTCGACTGGCATGGTGTGGGAACCTGCTGCGGATTGCGCATCGACGACGGCTTTCACCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail