Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01775
Gene name
Locationscaffold_02:427950..431297
Strand+
Gene length (bp)3347
Transcript length (bp)3291
Coding sequence length (bp)3291
Protein length (aa) 1097

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13426 PAS_9 PAS domain 7.6E-18 425 538
PF13426 PAS_9 PAS domain 4.5E-01 627 711
PF13426 PAS_9 PAS domain 5.3E-01 744 809
PF08447 PAS_3 PAS fold 3.0E-12 630 705
PF00320 GATA GATA zinc finger 1.3E-14 952 985
PF00989 PAS PAS fold 2.9E-06 612 715
PF08446 PAS_2 PAS fold 6.4E-02 748 791

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0043565 sequence-specific DNA binding Yes
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0050794 regulation of cellular process No
GO:0003676 nucleic acid binding No
GO:0050789 regulation of biological process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0080090 regulation of primary metabolic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0005488 binding No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0031323 regulation of cellular metabolic process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0051252 regulation of RNA metabolic process No
GO:0003677 DNA binding No
GO:0019222 regulation of metabolic process No
GO:2001141 regulation of RNA biosynthetic process No
GO:0065007 biological regulation No
GO:0060255 regulation of macromolecule metabolic process No
GO:0010468 regulation of gene expression No
GO:0008150 biological_process No
GO:0009889 regulation of biosynthetic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2358 0.8898 0.042 0.1059 0.1019 0.0014 0.1411 0.0139 0.0581 0.0031

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
GATA type zinc finger

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6396
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6528
Ophiocordyceps australis map64 (Brazil) OphauB2|4276
Ophiocordyceps camponoti-floridani Ophcf2|01775 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6349
Ophiocordyceps kimflemingae Ophio5|4975

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01775
MDGFYSRPQLPPQQLRRQLSRQRQHQQQQHQHQHQQQQHQQQQQQQQQQHQQQHQQQHQQQHQQQHQQQHQQQPQ
TQQPQAQQQRPTPQQSMSMPVPLHLQSQNPISQSMAGQSIMSGSSIDDMMRNNQGDLQRRRSMSQTYRDPAAQSQ
SPRRMSSVGGAADMMQFPSDNSNYHFNQSMTAGIPNINTGLHMADSLSNYMSEADDYSAISPDLMGSMIPASFAN
MDMGPIGNDSSAMGLFSTPGSSTAGCGAGSINNDFSSSQMASMGADYPLAVNSNGGSLAGTPSNYREGVRAGEEQ
DEDMLNMPTSQFNSMGSTPNTVANSIKLDPAVSAYNQNMPPALSRNVSSPGSFISPQRGSSSNSAAQPSGASDTT
APTTAPTPRESKDKAIYSKSGFDMLKALWLVATRKDPIIHLGAVDMSCAFVVCDVTMNDCPIIYVSDNFQNLTGY
SRHEIVGQNCRFLQAPDAKVEAGSKREFVDDGAVYNLKKMIHEGREVQQSLINYRKGGKPFLNLLTMIPIPWDTN
DIRYFIGFQIDLVECPDAISGQEMGGVTVNYKHTDIGQYIWTPPTTTHWEPENGQTLGVDDVSTLLQQFNPKGLV
SDWHKQSWDKMLLENTDDVVHVLSLKGLFLYLSPSCKRVLEYDAADLAGNSLSSVCHPSDIVPVTRELKDATAGN
QVNIVFRIRRKQSGYTWFESHGSLFVEQGKGRKCIILVGRKRPVFALSRHNLDANGGIGDSELWTKLSTSGMFLF
VSSNVRSLLDLQPESLIGTSIQDLMRKESRHEFGRSIEKARRGKIVSCKHEVQNRRGQGLQAQTILYPGDASAGQ
KPSFLLAQTKLLKASSRSLAHGSTAGCNKSVSGTPRSNPAQAQDNHCEGTISQPSGGALMPGTQDMALASDDNIF
DELRTTKCSSWQFELRQMEKVNRILAEELGGLLSNKKKRKRRKGVGNMVRDCANCHTRNTPEWRRGPSGQRDLCN
SCGLRWAKQTGRVSPRNSSRGGNNGNGDSQSKRSTSPIQSSPLHKELLAETPNPHASDAAHPVDGNGAVDPAHLG
GHMTGTSGTSVPGAKPSTTMPPPSQPSLAPGSSMTSIREERETSQS*
Coding >Ophcf2|01775
ATGGATGGCTTCTACTCCCGCCCCCAGCTACCACCTCAGCAGCTGAGGCGCCAGCTCTCACGCCAGCGTCAGCAC
CAGCAACAGCAGCATCAGCATCAGCATCAGCAGCAACAGCATCAGCAGCAACAGCAGCAACAGCAGCAACAGCAT
CAGCAACAGCATCAGCAACAGCATCAGCAACAGCATCAGCAACAGCATCAGCAACAGCATCAGCAGCAACCGCAA
ACTCAGCAGCCCCAGGCTCAGCAGCAACGGCCGACTCCCCAGCAATCCATGAGCATGCCCGTGCCGCTTCACCTC
CAATCGCAAAACCCCATCTCCCAGTCCATGGCAGGTCAGTCCATCATGTCTGGATCCTCGATCGACGACATGATG
CGCAACAACCAGGGCGATTTGCAACGGCGAAGGAGCATGTCGCAGACGTATCGCGACCCCGCCGCTCAGTCGCAG
AGCCCGAGGCGAATGTCGTCGGTCGGAGGCGCCGCAGACATGATGCAGTTCCCCTCCGACAACAGCAACTATCAC
TTCAACCAGTCCATGACGGCCGGCATCCCCAATATCAACACGGGGCTCCACATGGCCGATTCCCTGAGTAATTAC
ATGTCCGAGGCCGACGATTACTCTGCCATTTCTCCGGATTTGATGGGCTCCATGATCCCAGCTTCGTTTGCCAAT
ATGGACATGGGACCCATCGGCAATGACTCGTCCGCCATGGGCCTATTTTCCACCCCTGGCTCCTCCACTGCGGGA
TGTGGCGCCGGCTCCATAAACAACGACTTCAGTTCGAGTCAGATGGCCTCGATGGGCGCCGACTACCCCTTGGCC
GTCAATTCCAATGGCGGCTCCCTGGCGGGCACGCCCTCCAACTACCGAGAAGGCGTGAGGGCCGGAGAAGAACAG
GACGAAGACATGTTGAACATGCCGACCTCGCAGTTCAACTCGATGGGTTCCACGCCCAACACCGTGGCAAATAGC
ATCAAGCTCGATCCCGCCGTCAGCGCCTACAACCAGAATATGCCGCCTGCTCTATCGCGTAACGTCTCCTCTCCG
GGCTCCTTCATCTCTCCTCAACGCGGCAGCTCATCCAACAGCGCAGCCCAGCCCAGCGGCGCTTCCGACACCACC
GCCCCGACAACGGCACCGACGCCGCGCGAGTCCAAGGACAAGGCCATCTACTCCAAGAGCGGCTTCGACATGCTC
AAGGCCCTGTGGCTGGTCGCCACCCGCAAAGATCCCATCATCCACCTCGGCGCCGTCGACATGTCTTGTGCTTTT
GTCGTCTGTGACGTCACCATGAACGACTGTCCCATCATCTACGTCTCGGACAATTTCCAGAACCTGACGGGCTAC
AGCCGCCACGAGATTGTCGGCCAAAACTGCCGCTTCCTTCAGGCCCCGGACGCCAAAGTCGAGGCTGGCTCGAAG
CGCGAGTTCGTCGACGACGGTGCCGTGTACAACCTCAAGAAGATGATACACGAGGGGCGCGAGGTCCAACAGAGC
CTCATCAACTACCGCAAGGGCGGTAAGCCATTCCTCAACCTGCTGACCATGATACCCATCCCGTGGGACACGAAC
GACATAAGGTACTTTATAGGCTTTCAGATCGACCTCGTCGAGTGCCCCGACGCCATCTCGGGCCAGGAAATGGGC
GGCGTCACCGTCAACTACAAGCACACCGACATTGGGCAATACATCTGGACCCCGCCGACCACCACTCATTGGGAG
CCCGAGAACGGACAGACGCTGGGCGTCGACGATGTCTCGACCCTGTTGCAGCAGTTCAACCCCAAGGGGCTGGTG
TCGGATTGGCACAAACAATCGTGGGACAAGATGCTTCTGGAGAACACCGACGACGTCGTTCACGTCCTGTCGCTA
AAAGGCTTGTTCCTCTACCTTTCGCCCTCGTGCAAGCGGGTCCTCGAATACGATGCCGCCGACCTCGCCGGAAAC
TCGCTCTCCTCCGTCTGCCATCCGTCTGATATCGTGCCCGTGACGCGGGAGCTCAAGGACGCCACCGCCGGCAAC
CAAGTCAACATTGTCTTCCGCATACGGCGGAAGCAAAGCGGATACACCTGGTTCGAGAGCCACGGGTCGCTCTTC
GTCGAGCAAGGCAAGGGCCGCAAGTGCATCATCCTGGTCGGACGCAAGCGACCAGTCTTCGCGCTCAGCAGACAT
AACCTGGATGCCAACGGGGGCATCGGCGACAGCGAGCTGTGGACCAAGCTCTCCACGTCCGGCATGTTCCTCTTC
GTCTCGTCCAATGTGCGGTCCCTCCTCGACCTCCAGCCGGAGTCCCTGATCGGCACCAGCATACAGGACCTGATG
CGTAAGGAGTCTCGGCACGAGTTCGGTCGGTCCATCGAGAAGGCCAGGAGGGGCAAGATTGTGTCGTGCAAGCAC
GAGGTGCAGAACCGACGAGGTCAGGGCCTGCAGGCTCAGACGATTCTGTACCCCGGCGATGCCTCGGCCGGCCAG
AAACCGTCGTTTCTACTGGCCCAGACGAAGCTTCTCAAGGCTTCTTCGCGAAGCCTAGCCCACGGCAGCACCGCG
GGATGCAACAAGTCGGTTTCGGGGACGCCGAGATCGAATCCGGCACAGGCACAAGATAACCATTGCGAAGGAACG
ATATCGCAGCCGTCCGGAGGTGCGCTGATGCCGGGCACGCAGGACATGGCGCTGGCGTCGGACGATAACATCTTT
GACGAGCTCCGGACGACCAAATGCTCGAGCTGGCAGTTTGAGCTCAGGCAGATGGAAAAGGTCAACAGGATCTTG
GCCGAGGAACTCGGGGGTCTCCTGTCGAACAAGAAGAAGAGGAAGCGGAGAAAGGGTGTGGGCAACATGGTGCGA
GACTGCGCCAACTGCCACACGCGGAATACGCCCGAGTGGCGAAGAGGACCCAGCGGCCAACGAGATCTCTGCAAC
AGCTGCGGACTTCGTTGGGCCAAGCAGACAGGCCGCGTCTCTCCTCGCAACTCGTCAAGAGGAGGCAACAACGGG
AACGGCGACTCTCAGAGCAAGAGATCCACCTCACCGATCCAATCCTCGCCTCTTCACAAGGAGCTTCTAGCCGAG
ACGCCTAACCCGCACGCCTCGGACGCCGCCCACCCGGTCGACGGCAACGGCGCAGTCGATCCCGCGCATCTCGGA
GGCCACATGACGGGCACGTCGGGAACGTCGGTGCCCGGTGCGAAGCCATCTACGACGATGCCACCGCCAAGCCAG
CCTTCGCTCGCCCCTGGCTCGTCCATGACGTCGATTCGAGAAGAGCGCGAAACGAGTCAATCGTAG
Transcript >Ophcf2|01775
ATGGATGGCTTCTACTCCCGCCCCCAGCTACCACCTCAGCAGCTGAGGCGCCAGCTCTCACGCCAGCGTCAGCAC
CAGCAACAGCAGCATCAGCATCAGCATCAGCAGCAACAGCATCAGCAGCAACAGCAGCAACAGCAGCAACAGCAT
CAGCAACAGCATCAGCAACAGCATCAGCAACAGCATCAGCAACAGCATCAGCAACAGCATCAGCAGCAACCGCAA
ACTCAGCAGCCCCAGGCTCAGCAGCAACGGCCGACTCCCCAGCAATCCATGAGCATGCCCGTGCCGCTTCACCTC
CAATCGCAAAACCCCATCTCCCAGTCCATGGCAGGTCAGTCCATCATGTCTGGATCCTCGATCGACGACATGATG
CGCAACAACCAGGGCGATTTGCAACGGCGAAGGAGCATGTCGCAGACGTATCGCGACCCCGCCGCTCAGTCGCAG
AGCCCGAGGCGAATGTCGTCGGTCGGAGGCGCCGCAGACATGATGCAGTTCCCCTCCGACAACAGCAACTATCAC
TTCAACCAGTCCATGACGGCCGGCATCCCCAATATCAACACGGGGCTCCACATGGCCGATTCCCTGAGTAATTAC
ATGTCCGAGGCCGACGATTACTCTGCCATTTCTCCGGATTTGATGGGCTCCATGATCCCAGCTTCGTTTGCCAAT
ATGGACATGGGACCCATCGGCAATGACTCGTCCGCCATGGGCCTATTTTCCACCCCTGGCTCCTCCACTGCGGGA
TGTGGCGCCGGCTCCATAAACAACGACTTCAGTTCGAGTCAGATGGCCTCGATGGGCGCCGACTACCCCTTGGCC
GTCAATTCCAATGGCGGCTCCCTGGCGGGCACGCCCTCCAACTACCGAGAAGGCGTGAGGGCCGGAGAAGAACAG
GACGAAGACATGTTGAACATGCCGACCTCGCAGTTCAACTCGATGGGTTCCACGCCCAACACCGTGGCAAATAGC
ATCAAGCTCGATCCCGCCGTCAGCGCCTACAACCAGAATATGCCGCCTGCTCTATCGCGTAACGTCTCCTCTCCG
GGCTCCTTCATCTCTCCTCAACGCGGCAGCTCATCCAACAGCGCAGCCCAGCCCAGCGGCGCTTCCGACACCACC
GCCCCGACAACGGCACCGACGCCGCGCGAGTCCAAGGACAAGGCCATCTACTCCAAGAGCGGCTTCGACATGCTC
AAGGCCCTGTGGCTGGTCGCCACCCGCAAAGATCCCATCATCCACCTCGGCGCCGTCGACATGTCTTGTGCTTTT
GTCGTCTGTGACGTCACCATGAACGACTGTCCCATCATCTACGTCTCGGACAATTTCCAGAACCTGACGGGCTAC
AGCCGCCACGAGATTGTCGGCCAAAACTGCCGCTTCCTTCAGGCCCCGGACGCCAAAGTCGAGGCTGGCTCGAAG
CGCGAGTTCGTCGACGACGGTGCCGTGTACAACCTCAAGAAGATGATACACGAGGGGCGCGAGGTCCAACAGAGC
CTCATCAACTACCGCAAGGGCGGTAAGCCATTCCTCAACCTGCTGACCATGATACCCATCCCGTGGGACACGAAC
GACATAAGGTACTTTATAGGCTTTCAGATCGACCTCGTCGAGTGCCCCGACGCCATCTCGGGCCAGGAAATGGGC
GGCGTCACCGTCAACTACAAGCACACCGACATTGGGCAATACATCTGGACCCCGCCGACCACCACTCATTGGGAG
CCCGAGAACGGACAGACGCTGGGCGTCGACGATGTCTCGACCCTGTTGCAGCAGTTCAACCCCAAGGGGCTGGTG
TCGGATTGGCACAAACAATCGTGGGACAAGATGCTTCTGGAGAACACCGACGACGTCGTTCACGTCCTGTCGCTA
AAAGGCTTGTTCCTCTACCTTTCGCCCTCGTGCAAGCGGGTCCTCGAATACGATGCCGCCGACCTCGCCGGAAAC
TCGCTCTCCTCCGTCTGCCATCCGTCTGATATCGTGCCCGTGACGCGGGAGCTCAAGGACGCCACCGCCGGCAAC
CAAGTCAACATTGTCTTCCGCATACGGCGGAAGCAAAGCGGATACACCTGGTTCGAGAGCCACGGGTCGCTCTTC
GTCGAGCAAGGCAAGGGCCGCAAGTGCATCATCCTGGTCGGACGCAAGCGACCAGTCTTCGCGCTCAGCAGACAT
AACCTGGATGCCAACGGGGGCATCGGCGACAGCGAGCTGTGGACCAAGCTCTCCACGTCCGGCATGTTCCTCTTC
GTCTCGTCCAATGTGCGGTCCCTCCTCGACCTCCAGCCGGAGTCCCTGATCGGCACCAGCATACAGGACCTGATG
CGTAAGGAGTCTCGGCACGAGTTCGGTCGGTCCATCGAGAAGGCCAGGAGGGGCAAGATTGTGTCGTGCAAGCAC
GAGGTGCAGAACCGACGAGGTCAGGGCCTGCAGGCTCAGACGATTCTGTACCCCGGCGATGCCTCGGCCGGCCAG
AAACCGTCGTTTCTACTGGCCCAGACGAAGCTTCTCAAGGCTTCTTCGCGAAGCCTAGCCCACGGCAGCACCGCG
GGATGCAACAAGTCGGTTTCGGGGACGCCGAGATCGAATCCGGCACAGGCACAAGATAACCATTGCGAAGGAACG
ATATCGCAGCCGTCCGGAGGTGCGCTGATGCCGGGCACGCAGGACATGGCGCTGGCGTCGGACGATAACATCTTT
GACGAGCTCCGGACGACCAAATGCTCGAGCTGGCAGTTTGAGCTCAGGCAGATGGAAAAGGTCAACAGGATCTTG
GCCGAGGAACTCGGGGGTCTCCTGTCGAACAAGAAGAAGAGGAAGCGGAGAAAGGGTGTGGGCAACATGGTGCGA
GACTGCGCCAACTGCCACACGCGGAATACGCCCGAGTGGCGAAGAGGACCCAGCGGCCAACGAGATCTCTGCAAC
AGCTGCGGACTTCGTTGGGCCAAGCAGACAGGCCGCGTCTCTCCTCGCAACTCGTCAAGAGGAGGCAACAACGGG
AACGGCGACTCTCAGAGCAAGAGATCCACCTCACCGATCCAATCCTCGCCTCTTCACAAGGAGCTTCTAGCCGAG
ACGCCTAACCCGCACGCCTCGGACGCCGCCCACCCGGTCGACGGCAACGGCGCAGTCGATCCCGCGCATCTCGGA
GGCCACATGACGGGCACGTCGGGAACGTCGGTGCCCGGTGCGAAGCCATCTACGACGATGCCACCGCCAAGCCAG
CCTTCGCTCGCCCCTGGCTCGTCCATGACGTCGATTCGAGAAGAGCGCGAAACGAGTCAATCGTAG
Gene >Ophcf2|01775
ATGGATGGCTTCTACTCCCGCCCCCAGCTACCACCTCAGCAGCTGAGGCGCCAGCTCTCACGCCAGCGTCAGCAC
CAGCAACAGCAGCATCAGCATCAGCATCAGCAGCAACAGCATCAGCAGCAACAGCAGCAACAGCAGCAACAGCAT
CAGCAACAGCATCAGCAACAGCATCAGCAACAGCATCAGCAACAGCATCAGCAACAGCATCAGCAGCAACCGCAA
ACTCAGCAGCCCCAGGCTCAGCAGCAACGGCCGACTCCCCAGCAATCCATGAGCATGCCCGTGCCGCTTCACCTC
CAATCGCAAAACCCCATCTCCCAGTCCATGGCAGGTCAGTCCATCATGTCTGGATCCTCGATCGACGACATGATG
CGCAACAACCAGGGCGATTTGCAACGGCGAAGGAGCATGTCGCAGACGTATCGCGACCCCGCCGCTCAGTCGCAG
AGCCCGAGGCGAATGTCGTCGGTCGGAGGCGCCGCAGACATGATGCAGTTCCCCTCCGACAACAGCAACTATCAC
TTCAACCAGTCCATGACGGCCGGCATCCCCAATATCAACACGGGGCTCCACATGGCCGATTCCCTGAGTAATTAC
ATGTCCGAGGCCGACGATTACTCTGCCATTTCTCCGGATTTGATGGGCTCCATGATCCCAGCTTCGTTTGCCAAT
ATGGACATGGGACCCATCGGCAATGACTCGTCCGCCATGGGCCTATTTTCCACCCCTGGCTCCTCCACTGCGGGA
TGTGGCGCCGGCTCCATAAACAACGACTTCAGTTCGAGTCAGATGGCCTCGATGGGCGCCGACTACCCCTTGGCC
GTCAATTCCAATGGCGGCTCCCTGGCGGGCACGCCCTCCAACTACCGAGAAGGCGTGAGGGCCGGAGAAGAACAG
GACGAAGACATGTTGAACATGCCGACCTCGCAGTTCAACTCGATGGGTTCCACGCCCAACACCGTGGCAAATAGC
ATCAAGCTCGATCCCGCCGTCAGCGCCTACAACCAGAATATGCCGCCTGCTCTATCGCGTAACGTCTCCTCTCCG
GGCTCCTTCATCTCTCCTCAACGCGGCAGCTCATCCAACAGCGCAGCCCAGCCCAGCGGCGCTTCCGACACCACC
GCCCCGACAACGGCACCGACGCCGCGCGAGTCCAAGGACAAGGCCATCTACTCCAAGAGCGGCTTCGACATGCTC
AAGGCCCTGTGGCTGGTCGCCACCCGCAAAGATCCCATCATCCACCTCGGCGCCGTCGACATGTCTTGTGCTTTT
GTCGTCTGTGACGTCACCATGAACGACTGTCCCATCATCTACGTCTCGGACAATTTCCAGAACCTGACGGGCTAC
AGCCGCCACGAGATTGTCGGCCAAAACTGCCGCTTCCTTCAGGCCCCGGACGCCAAAGTCGAGGCTGGCTCGAAG
CGCGAGTTCGTCGACGACGGTGCCGTGTACAACCTCAAGAAGATGATACACGAGGGGCGCGAGGTCCAACAGAGC
CTCATCAACTACCGCAAGGGCGGTAAGCCATTCCTCAACCTGCTGACCATGATACCCATCCCGTGGGACACGAAC
GACATAAGGTACTTTATAGGCTTTCAGATCGACCTCGTCGAGTGCCCCGACGCCATCTCGGGCCAGGAAATGGGC
GGCGTCACCGTCAACTACAAGCACACCGACATTGGGCAATACATCTGGACCCCGCCGACCACCACTCATTGGGAG
CCCGAGAACGGACAGACGCTGGGCGTCGACGATGTCTCGACCCTGTTGCAGCAGTTCAACCCCAAGGGGCTGGTG
TCGGATTGGCACAAACAATCGTGGGACAAGATGCTTCTGGAGAACACCGACGACGTCGTTCACGTCCTGTCGCTA
AAAGGCTTGTTCCTCTACCTTTCGCCCTCGTGCAAGCGGGTCCTCGAATACGATGCCGCCGACCTCGCCGGAAAC
TCGCTCTCCTCCGTCTGCCATCCGTCTGATATCGTGCCCGTGACGCGGGAGCTCAAGGACGCCACCGCCGGCAAC
CAAGTCAACATTGTCTTCCGCATACGGCGGAAGCAAAGCGGATACACCTGGTTCGAGAGCCACGGGTCGCTCTTC
GTCGAGCAAGGCAAGGGCCGCAAGTGCATCATCCTGGTCGGACGCAAGCGACCAGTCTTCGCGCTCAGCAGACAT
AACCTGGATGCCAACGGGGGCATCGGCGACAGCGAGCTGTGGACCAAGCTCTCCACGTCCGGCATGTTCCTCTTC
GTCTCGTCCAATGTGCGGTCCCTCCTCGACCTCCAGCCGGAGTCCCTGATCGGCACCAGCATACAGGACCTGATG
CGTAAGGAGTCTCGGCACGAGTTCGGTCGGTCCATCGAGAAGGCCAGGAGGGGCAAGATTGTGTCGTGCAAGCAC
GAGGTGCAGAACCGACGAGGTCAGGGCCTGCAGGCTCAGACGATTCTGTACCCCGGCGATGCCTCGGCCGGCCAG
AAACCGTCGTTTCTACTGGCCCAGACGAAGCTTCTCAAGGCTTCTTCGCGAAGCCTAGCCCACGGCAGCACCGCG
GGATGCAACAAGTCGGTTTCGGGGACGCCGAGATCGAATCCGGCACAGGCACAAGATAACCATTGCGAAGGAACG
ATATCGCAGCCGTCCGGAGGTGCGCTGATGCCGGGCACGCAGGACATGGCGCTGGCGTCGGACGATAACATCTTT
GACGAGCTCCGGACGACCAAATGCTCGAGCTGGCAGTTTGAGCTCAGGCAGATGGAAAAGGTCAACAGGATCTTG
GCCGAGGAACTCGGGGGTCTCCTGTCGAACAAGAAGAAGAGGAAGCGGAGAAAGGGTGTGGGCAACATGGTGCGA
GACTGCGCCAACTGCCACACGCGGAATACGCCCGAGTGGCGAAGAGGACCCAGCGGCCAACGAGATCTCTGCAAC
AGCTGCGGACTTCGTTGGGCCAAGCAGGTGAGAGAAGGCGGTCTCGCTGTCTTTTCTGGTCTTGCTGACTTGTCG
TCCTGCAGACAGGCCGCGTCTCTCCTCGCAACTCGTCAAGAGGAGGCAACAACGGGAACGGCGACTCTCAGAGCA
AGAGATCCACCTCACCGATCCAATCCTCGCCTCTTCACAAGGAGCTTCTAGCCGAGACGCCTAACCCGCACGCCT
CGGACGCCGCCCACCCGGTCGACGGCAACGGCGCAGTCGATCCCGCGCATCTCGGAGGCCACATGACGGGCACGT
CGGGAACGTCGGTGCCCGGTGCGAAGCCATCTACGACGATGCCACCGCCAAGCCAGCCTTCGCTCGCCCCTGGCT
CGTCCATGACGTCGATTCGAGAAGAGCGCGAAACGAGTCAATCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail