Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01774
Gene name
Locationscaffold_02:422344..425920
Strand+
Gene length (bp)3576
Transcript length (bp)3291
Coding sequence length (bp)3291
Protein length (aa) 1097

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18829 Importin_rep_6 Importin repeat 6 7.9E-35 769 879
PF18808 Importin_rep_4 Importin repeat 8.2E-34 275 367
PF18816 Importin_rep_5 Importin repeat 4.6E-23 1011 1062
PF13513 HEAT_EZ HEAT-like repeat 1.0E-10 383 437
PF02985 HEAT HEAT repeat 2.6E-03 411 438
PF12460 MMS19_C RNAPII transcription regulator C-terminal 7.8E-10 449 566

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal|Nuclear export signal 0.6489 0.7698 0.0103 0.0865 0.0537 0.0104 0.0844 0.094 0.0693 0.004

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5090
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4829
Ophiocordyceps australis map64 (Brazil) OphauB2|4816
Ophiocordyceps camponoti-floridani Ophcf2|01774 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4909
Ophiocordyceps kimflemingae Ophio5|4974
Ophiocordyceps subramaniannii Hirsu2|3064

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01774
MSLLSDAVHAELTQLLQALQSADNDIRSQAEDHLQKSWTSPRPEVLLMGLVEQIQGAEDNATRSFAAVIFRRISS
KTRKIESGDNVDMFYSTPRNQAAVIRQKLLETLATEEDRAVRNKISDAVAEVARQYADNNDTWPELLGALFQLSQ
APEPEKRENAFRVFTTTPSIIERQHEEAVLQAFQKGFKDDAIRVRLAAMEAFAAFFRTISKKVQTKYFPLISDVL
NILPPIKESQESEDLSKALLALIDLAESAPKMFKQLFHNLVQFNISVIQDKELDNICRQNALELMATFADYAPSM
CRKDASYTNDMVTQCLSLMTDLGEDDDDAAEWLASDDLDQDESDQNHVAGEQAMDRLANKLGGQTILAPTFNWLP
RMMTSMAWRDRHAALMAISAISEGCRDLMIGELSQVLDLVVPALQDPHPRVRWAGCNALGQMSTDFAPKMQTDFY
DRVLKAIIPVLSSPEARVKSHAAAALVNFCEEAEKSVLVPYLDDLLSQLFQLLQSDKRYVQEQALSTIATIADAA
EAAFSKYYQSLMPLLVSVLQNQSEKEFRLLRSKAMECATLIALAVGRERLGADAMTLVNLLANIQTSITDADDPQ
AQYLMHCWGRMCRVLGADFMPFLDSVMPPVLELAMAKADIQLLDDDEQAEQIHGEEGWEFVPLKGKMIGIRTSTM
DDKHMAIELLLVYAQTLEGSFAPFVPNIMEKIALPGLAFFFHDATRYISAKLVPYLLNSYKKAFGCPSNELAGLW
HLTVDKLLEVLTAEPSIETLAVMYQCFYESMQVVGRDCLTPEYMKRFIDAVHSTIEDFQDRVAQRAEDKEGATAD
DVEDEAEETLLAIEDDQTLLSDMNKAFHSIFRNHGAAFLPAWERLMTTYQGFLASSDATQRQWGLCIVDDVLEYC
GPESHRYAGCISQPLIDGCRDASPAIRQAAAYGIGVAAHRGGAPWSQFLGGSVPFLFQVTQVPDARSEDNVYATE
NACAALAKILHYNSGSVANVQAVIAQWIDTLPVINDEEAAPYAYAYLAELIDQRHPAVMNHGSKLFLFVAQALEA
ETLQGQTATRVAAATKMLLTSASVDPTPLLQQFSQDSQRTIMGYFS*
Coding >Ophcf2|01774
ATGTCCTTGCTCTCTGACGCCGTCCACGCCGAGTTGACCCAGCTCCTTCAGGCCTTGCAGTCCGCCGACAATGAC
ATCCGTTCTCAGGCCGAGGACCATCTCCAGAAGAGCTGGACGAGCCCTCGTCCCGAGGTCCTGTTGATGGGTCTC
GTCGAGCAGATCCAAGGCGCCGAGGACAATGCCACTCGTTCCTTTGCTGCCGTCATATTCCGTCGCATCTCGTCC
AAAACGCGCAAGATCGAGTCGGGCGACAATGTCGACATGTTCTACTCCACACCAAGAAACCAAGCCGCAGTCATC
CGTCAGAAGCTCCTCGAGACTCTCGCGACTGAGGAGGATCGTGCGGTTCGCAACAAAATCAGTGACGCCGTCGCC
GAGGTCGCGCGGCAGTACGCCGATAACAATGATACTTGGCCTGAGCTTCTTGGCGCTCTTTTCCAGCTCAGTCAA
GCGCCCGAACCTGAAAAACGCGAAAACGCTTTCCGCGTCTTCACCACGACGCCCAGTATCATCGAGAGGCAGCAC
GAGGAGGCTGTTCTTCAGGCCTTTCAGAAAGGCTTCAAGGACGATGCCATCAGGGTCCGACTTGCGGCCATGGAA
GCCTTCGCGGCCTTCTTCAGAACTATCAGCAAAAAAGTGCAAACTAAATACTTTCCGCTCATTTCAGACGTTCTT
AACATCTTACCTCCAATTAAAGAGTCGCAGGAGTCGGAGGATCTAAGCAAGGCACTCTTGGCCCTCATCGATCTT
GCCGAGTCTGCGCCCAAAATGTTCAAACAGTTATTCCACAACCTCGTCCAGTTCAACATATCCGTCATACAGGAC
AAGGAACTCGACAACATCTGCAGGCAAAATGCCCTCGAGCTCATGGCCACTTTTGCCGATTACGCTCCGTCGATG
TGCCGGAAGGACGCCTCTTACACGAATGATATGGTCACGCAGTGTCTGAGCCTCATGACAGACCTTGGCGAGGAC
GACGACGACGCCGCAGAGTGGCTCGCATCTGATGACCTCGATCAAGACGAGAGCGATCAAAACCACGTGGCCGGC
GAGCAGGCTATGGACCGTCTCGCCAACAAGCTCGGCGGACAGACCATCCTGGCTCCCACCTTCAACTGGCTTCCC
CGAATGATGACGTCCATGGCTTGGAGAGACCGTCACGCGGCCCTCATGGCCATCTCGGCCATCTCGGAAGGATGC
CGCGACCTCATGATTGGGGAGCTCAGCCAGGTCCTCGATCTGGTGGTCCCGGCCTTGCAAGATCCGCACCCGCGC
GTCCGCTGGGCAGGATGCAACGCGCTGGGGCAGATGAGCACCGATTTTGCCCCCAAGATGCAGACTGATTTCTAC
GACAGGGTGCTCAAGGCCATTATTCCGGTCCTCAGCTCCCCCGAGGCCCGCGTTAAGTCTCACGCGGCCGCGGCC
CTGGTCAACTTTTGCGAGGAGGCAGAAAAGTCGGTCCTGGTGCCGTATCTCGACGACCTCTTGTCCCAACTGTTC
CAGCTGCTCCAGAGCGACAAGCGCTACGTCCAGGAGCAGGCCTTGTCGACCATCGCCACCATTGCCGATGCGGCC
GAAGCGGCCTTTTCCAAGTACTACCAGTCCTTGATGCCCCTCCTAGTCAGTGTCCTTCAAAACCAGAGCGAAAAG
GAGTTCCGGCTCCTGCGGTCCAAAGCCATGGAATGCGCCACTCTCATCGCTCTGGCGGTAGGGCGGGAACGGCTC
GGGGCCGACGCCATGACGCTCGTCAATCTCCTCGCCAACATACAGACCAGCATCACGGATGCCGACGATCCGCAA
GCGCAGTATCTGATGCACTGCTGGGGACGCATGTGTCGCGTGCTGGGCGCCGACTTCATGCCGTTCCTAGATAGC
GTCATGCCCCCCGTTCTCGAACTGGCCATGGCCAAAGCCGACATACAGCTGCTCGACGACGACGAACAAGCCGAG
CAGATCCACGGCGAGGAGGGCTGGGAGTTCGTCCCGCTCAAGGGCAAGATGATTGGCATTCGGACGAGTACCATG
GACGACAAGCACATGGCCATTGAGCTCCTGCTCGTCTACGCTCAGACACTCGAGGGCTCGTTTGCGCCCTTCGTG
CCCAACATCATGGAGAAGATTGCGCTTCCCGGCCTCGCCTTCTTCTTCCACGATGCCACCCGTTACATCTCCGCC
AAACTGGTCCCCTACCTCTTGAACTCGTACAAGAAGGCATTCGGCTGCCCCTCCAACGAACTTGCCGGTCTGTGG
CACTTGACCGTGGACAAGCTGTTGGAGGTCTTGACGGCCGAGCCGTCGATCGAGACGCTGGCCGTCATGTACCAA
TGCTTCTACGAGTCCATGCAAGTGGTCGGCAGGGACTGCCTCACCCCCGAGTACATGAAGCGTTTCATCGACGCC
GTTCATTCCACAATCGAGGACTTCCAGGACAGAGTCGCCCAGCGTGCTGAGGATAAGGAGGGCGCGACGGCCGAC
GATGTCGAGGACGAGGCCGAGGAGACGCTGTTGGCCATCGAGGACGATCAGACGCTCCTGTCGGATATGAACAAG
GCGTTTCACTCCATCTTCCGGAACCACGGCGCGGCTTTCCTACCTGCTTGGGAGCGGCTCATGACGACTTACCAA
GGCTTTCTCGCTTCGTCTGACGCGACTCAGCGGCAGTGGGGGCTCTGCATCGTGGACGACGTGCTGGAGTACTGC
GGGCCGGAGAGCCATCGGTATGCCGGCTGCATCTCGCAACCTCTGATTGACGGCTGCAGGGACGCATCACCGGCC
ATCAGGCAGGCCGCAGCTTACGGTATCGGCGTCGCGGCTCATCGAGGCGGCGCTCCGTGGTCTCAGTTCCTCGGA
GGATCGGTGCCGTTTCTTTTCCAAGTCACGCAGGTGCCCGACGCCCGGAGCGAAGACAACGTCTACGCGACGGAG
AATGCGTGCGCTGCTCTGGCCAAGATCTTGCACTACAACTCGGGCAGCGTCGCAAATGTTCAAGCCGTGATTGCG
CAGTGGATAGACACGCTACCGGTGATCAACGATGAGGAGGCGGCGCCGTACGCCTATGCCTACCTGGCCGAGCTT
ATTGATCAACGCCACCCTGCGGTCATGAACCACGGCAGCAAGCTGTTTCTGTTTGTGGCTCAGGCTCTCGAAGCA
GAGACTCTCCAGGGACAAACAGCGACGAGAGTGGCAGCGGCCACCAAGATGCTCCTCACAAGTGCCAGCGTGGAC
CCGACGCCGCTGCTCCAGCAATTTTCTCAAGACTCGCAGCGGACTATTATGGGGTACTTCAGCTAG
Transcript >Ophcf2|01774
ATGTCCTTGCTCTCTGACGCCGTCCACGCCGAGTTGACCCAGCTCCTTCAGGCCTTGCAGTCCGCCGACAATGAC
ATCCGTTCTCAGGCCGAGGACCATCTCCAGAAGAGCTGGACGAGCCCTCGTCCCGAGGTCCTGTTGATGGGTCTC
GTCGAGCAGATCCAAGGCGCCGAGGACAATGCCACTCGTTCCTTTGCTGCCGTCATATTCCGTCGCATCTCGTCC
AAAACGCGCAAGATCGAGTCGGGCGACAATGTCGACATGTTCTACTCCACACCAAGAAACCAAGCCGCAGTCATC
CGTCAGAAGCTCCTCGAGACTCTCGCGACTGAGGAGGATCGTGCGGTTCGCAACAAAATCAGTGACGCCGTCGCC
GAGGTCGCGCGGCAGTACGCCGATAACAATGATACTTGGCCTGAGCTTCTTGGCGCTCTTTTCCAGCTCAGTCAA
GCGCCCGAACCTGAAAAACGCGAAAACGCTTTCCGCGTCTTCACCACGACGCCCAGTATCATCGAGAGGCAGCAC
GAGGAGGCTGTTCTTCAGGCCTTTCAGAAAGGCTTCAAGGACGATGCCATCAGGGTCCGACTTGCGGCCATGGAA
GCCTTCGCGGCCTTCTTCAGAACTATCAGCAAAAAAGTGCAAACTAAATACTTTCCGCTCATTTCAGACGTTCTT
AACATCTTACCTCCAATTAAAGAGTCGCAGGAGTCGGAGGATCTAAGCAAGGCACTCTTGGCCCTCATCGATCTT
GCCGAGTCTGCGCCCAAAATGTTCAAACAGTTATTCCACAACCTCGTCCAGTTCAACATATCCGTCATACAGGAC
AAGGAACTCGACAACATCTGCAGGCAAAATGCCCTCGAGCTCATGGCCACTTTTGCCGATTACGCTCCGTCGATG
TGCCGGAAGGACGCCTCTTACACGAATGATATGGTCACGCAGTGTCTGAGCCTCATGACAGACCTTGGCGAGGAC
GACGACGACGCCGCAGAGTGGCTCGCATCTGATGACCTCGATCAAGACGAGAGCGATCAAAACCACGTGGCCGGC
GAGCAGGCTATGGACCGTCTCGCCAACAAGCTCGGCGGACAGACCATCCTGGCTCCCACCTTCAACTGGCTTCCC
CGAATGATGACGTCCATGGCTTGGAGAGACCGTCACGCGGCCCTCATGGCCATCTCGGCCATCTCGGAAGGATGC
CGCGACCTCATGATTGGGGAGCTCAGCCAGGTCCTCGATCTGGTGGTCCCGGCCTTGCAAGATCCGCACCCGCGC
GTCCGCTGGGCAGGATGCAACGCGCTGGGGCAGATGAGCACCGATTTTGCCCCCAAGATGCAGACTGATTTCTAC
GACAGGGTGCTCAAGGCCATTATTCCGGTCCTCAGCTCCCCCGAGGCCCGCGTTAAGTCTCACGCGGCCGCGGCC
CTGGTCAACTTTTGCGAGGAGGCAGAAAAGTCGGTCCTGGTGCCGTATCTCGACGACCTCTTGTCCCAACTGTTC
CAGCTGCTCCAGAGCGACAAGCGCTACGTCCAGGAGCAGGCCTTGTCGACCATCGCCACCATTGCCGATGCGGCC
GAAGCGGCCTTTTCCAAGTACTACCAGTCCTTGATGCCCCTCCTAGTCAGTGTCCTTCAAAACCAGAGCGAAAAG
GAGTTCCGGCTCCTGCGGTCCAAAGCCATGGAATGCGCCACTCTCATCGCTCTGGCGGTAGGGCGGGAACGGCTC
GGGGCCGACGCCATGACGCTCGTCAATCTCCTCGCCAACATACAGACCAGCATCACGGATGCCGACGATCCGCAA
GCGCAGTATCTGATGCACTGCTGGGGACGCATGTGTCGCGTGCTGGGCGCCGACTTCATGCCGTTCCTAGATAGC
GTCATGCCCCCCGTTCTCGAACTGGCCATGGCCAAAGCCGACATACAGCTGCTCGACGACGACGAACAAGCCGAG
CAGATCCACGGCGAGGAGGGCTGGGAGTTCGTCCCGCTCAAGGGCAAGATGATTGGCATTCGGACGAGTACCATG
GACGACAAGCACATGGCCATTGAGCTCCTGCTCGTCTACGCTCAGACACTCGAGGGCTCGTTTGCGCCCTTCGTG
CCCAACATCATGGAGAAGATTGCGCTTCCCGGCCTCGCCTTCTTCTTCCACGATGCCACCCGTTACATCTCCGCC
AAACTGGTCCCCTACCTCTTGAACTCGTACAAGAAGGCATTCGGCTGCCCCTCCAACGAACTTGCCGGTCTGTGG
CACTTGACCGTGGACAAGCTGTTGGAGGTCTTGACGGCCGAGCCGTCGATCGAGACGCTGGCCGTCATGTACCAA
TGCTTCTACGAGTCCATGCAAGTGGTCGGCAGGGACTGCCTCACCCCCGAGTACATGAAGCGTTTCATCGACGCC
GTTCATTCCACAATCGAGGACTTCCAGGACAGAGTCGCCCAGCGTGCTGAGGATAAGGAGGGCGCGACGGCCGAC
GATGTCGAGGACGAGGCCGAGGAGACGCTGTTGGCCATCGAGGACGATCAGACGCTCCTGTCGGATATGAACAAG
GCGTTTCACTCCATCTTCCGGAACCACGGCGCGGCTTTCCTACCTGCTTGGGAGCGGCTCATGACGACTTACCAA
GGCTTTCTCGCTTCGTCTGACGCGACTCAGCGGCAGTGGGGGCTCTGCATCGTGGACGACGTGCTGGAGTACTGC
GGGCCGGAGAGCCATCGGTATGCCGGCTGCATCTCGCAACCTCTGATTGACGGCTGCAGGGACGCATCACCGGCC
ATCAGGCAGGCCGCAGCTTACGGTATCGGCGTCGCGGCTCATCGAGGCGGCGCTCCGTGGTCTCAGTTCCTCGGA
GGATCGGTGCCGTTTCTTTTCCAAGTCACGCAGGTGCCCGACGCCCGGAGCGAAGACAACGTCTACGCGACGGAG
AATGCGTGCGCTGCTCTGGCCAAGATCTTGCACTACAACTCGGGCAGCGTCGCAAATGTTCAAGCCGTGATTGCG
CAGTGGATAGACACGCTACCGGTGATCAACGATGAGGAGGCGGCGCCGTACGCCTATGCCTACCTGGCCGAGCTT
ATTGATCAACGCCACCCTGCGGTCATGAACCACGGCAGCAAGCTGTTTCTGTTTGTGGCTCAGGCTCTCGAAGCA
GAGACTCTCCAGGGACAAACAGCGACGAGAGTGGCAGCGGCCACCAAGATGCTCCTCACAAGTGCCAGCGTGGAC
CCGACGCCGCTGCTCCAGCAATTTTCTCAAGACTCGCAGCGGACTATTATGGGGTACTTCAGCTAG
Gene >Ophcf2|01774
ATGTCCTTGCTCTCTGACGCCGTCCACGCCGAGTTGACCCAGCTCCTTCAGGCCTTGCAGTCCGCCGACAATGAC
ATCCGTTCTCAGGCCGAGGACCATCTCCAGAAGAGCTGGACGAGCCCTCGTCCCGAGGTCCTGTTGATGGGTCTC
GTCGAGCAGATCCAAGGCGCCGAGGACAATGCCGTGAGTCCTGTCTGAGATTCCCTTTCTATGCGATAATTCCGG
CTGACGCGTCGACTCTCACAGACTCGTTCCTTTGCTGCCGTCATATTCCGTCGCATCTCGTCCAAAACGCGCAAG
ATCGAGTCGGGCGACAATGTCGACATGTTCTACTCCACACCAAGAAACCAAGCCGCAGTCATCCGTCAGAAGCTC
CTCGAGACTCTCGCGACTGAGGAGGATCGTGCGGTTCGCAACAAAATCAGTGACGCCGTCGCCGAGGTCGCGCGG
CAGTACGCCGATAACAGTCAGTTCGCCCCGTCATTCTTTTTCTCGCTGTCGGGCGTCTCTTCTAATTCTCAGTTT
AGATGATACTTGGCCTGAGCTTCTTGGCGCTCTTTTCCAGCTCAGTCAAGCGCCCGAACCTGAAAAACGCGAAAA
CGCTTTCCGCGTCTTCACCACGACGCCCAGTATCATCGAGAGGCAGCACGAGGAGGCTGTTCTTCAGGCCTTTCA
GAAAGGCTTCAAGGACGATGCCATCAGGGTAAGTTCATCACCCGAATGCGGGTCATGGCACGCTAAGCCATCTGT
CCAGGTCCGACTTGCGGCCATGGAAGCCTTCGCGGCCTTCTTCAGAACTATCAGCAAAAAAGTGCAAACTAAATA
CTTTCCGCTCATTTCAGACGTTCTTAACATCTTACCTCCAATTAAAGAGTCGCAGGAGTCGGAGGATCTAAGCAA
GGCACTCTTGGCCCTCATCGATCTTGCCGAGTCTGCGCCCAAAATGTTCAAACAGTTATTCCACAACCTCGTCCA
GTTCAACATATCCGTCATACAGGACAAGGAACTCGACAACATCTGCAGGCAAAATGCCCTCGAGCTCATGGCCAC
TTTTGCCGATTACGCTCCGTCGATGTGCCGGAAGGACGCCTCTTACACGAATGATATGGTCACGCAGTGTCTGAG
CCTCATGACAGACCTTGGCGAGGACGACGACGACGCCGCAGAGTGGCTCGCATCTGATGACGTGAGTAAAGAGTC
GAGGGATCCCGTCGTCCAAAGATGAATATTGACACGCATTTCTAGCTCGATCAAGACGAGAGCGATCAAAACCAC
GTGGCCGGCGAGCAGGCTATGGACCGTCTCGCCAACAAGCTCGGCGGACAGACCATCCTGGCTCCCACCTTCAAC
TGGCTTCCCCGAATGATGACGTCCATGGCTTGGAGAGACCGTCACGCGGCCCTCATGGCCATCTCGGCCATCTCG
GAAGGATGCCGCGACCTCATGATTGGGGAGCTCAGCCAGGTCCTCGATCTGGTGGTCCCGGCCTTGCAAGATCCG
CACCCGCGCGTCCGCTGGGCAGGATGCAACGCGCTGGGGCAGATGAGCACCGATTTTGCCCCCAAGATGCAGACT
GATTTCTACGACAGGGTGCTCAAGGCCATTATTCCGGTCCTCAGCTCCCCCGAGGCCCGCGTTAAGTCTCACGCG
GCCGCGGCCCTGGTCAACTTTTGCGAGGAGGCAGAAAAGTCGGTCCTGGTGCCGTATCTCGACGACCTCTTGTCC
CAACTGTTCCAGCTGCTCCAGAGCGACAAGCGCTACGTCCAGGAGCAGGCCTTGTCGACCATCGCCACCATTGCC
GATGCGGCCGAAGCGGCCTTTTCCAAGTACTACCAGTCCTTGATGCCCCTCCTAGTCAGTGTCCTTCAAAACCAG
AGCGAAAAGGAGTTCCGGCTCCTGCGGTCCAAAGCCATGGAATGCGCCACTCTCATCGCTCTGGCGGTAGGGCGG
GAACGGCTCGGGGCCGACGCCATGACGCTCGTCAATCTCCTCGCCAACATACAGACCAGCATCACGGATGCCGAC
GATCCGCAAGCGCAGTATCTGATGCACTGCTGGGGACGCATGTGTCGCGTGCTGGGCGCCGACTTCATGCCGTTC
CTAGATAGCGTCATGCCCCCCGTTCTCGAACTGGCCATGGCCAAAGCCGACATACAGCTGCTCGACGACGACGAA
CAAGCCGAGCAGATCCACGGCGAGGAGGGCTGGGAGTTCGTCCCGCTCAAGGGCAAGATGATTGGCATTCGGACG
AGTACCATGGACGACAAGCACATGGCCATTGAGCTCCTGCTCGTCTACGCTCAGACACTCGAGGGCTCGTTTGCG
CCCTTCGTGCCCAACATCATGGAGAAGATTGCGCTTCCCGGCCTCGCCTTCTTCTTCCACGATGCCACCCGTTAC
ATCTCCGCCAAACTGGTCCCCTACCTCTTGAACTCGTACAAGAAGGCATTCGGCTGCCCCTCCAACGAACTTGCC
GGTCTGTGGCACTTGACCGTGGACAAGCTGTTGGAGGTCTTGACGGCCGAGCCGTCGATCGAGACGCTGGCCGTC
ATGTACCAATGCTTCTACGAGTCCATGCAAGTGGTCGGCAGGGACTGCCTCACCCCCGAGTACATGAAGCGTTTC
ATCGACGCCGTTCATTCCACAATCGAGGACTTCCAGGACAGAGTCGCCCAGCGTGCTGAGGATAAGGAGGGCGCG
ACGGCCGACGATGTCGAGGACGAGGCCGAGGAGACGCTGTTGGCCATCGAGGACGATCAGACGCTCCTGTCGGAT
ATGAACAAGGCGTTTCACTCCATCTTCCGGAACCACGGCGCGGCTTTCCTACCTGCTTGGGAGCGGCTCATGACG
ACTTACCAAGGCTTTCTCGCTTCGTCTGACGCGACTCAGCGGCAGTGGGGGCTCTGCATCGTGGACGACGTGCTG
GAGTACTGCGGGCCGGAGAGCCATCGGTATGCCGGCTGCATCTCGCAACCTCTGATTGACGGCTGCAGGGACGCA
TCACCGGCCATCAGGCAGGCCGCAGCTTACGGTATCGGCGTCGCGGCTCATCGAGGCGGCGCTCCGTGGTCTCAG
TTCCTCGGAGGATCGGTGCCGTTTCTTTTCCAAGTCACGCAGGTGCCCGACGCCCGGAGCGAAGACAACGTCTAC
GCGACGGAGAATGCGTGCGCTGCTCTGGCCAAGATCTTGCACTACAACTCGGGCAGCGTCGCAAATGTTCAAGCC
GTGATTGCGCAGTGGATAGACACGCTACCGGTGATCAACGATGAGGAGGCGGCGCCGTACGCCTATGCCTACCTG
GCCGAGCTTATTGATCAGTAGGTCTTGCGAATCTGGCGAAAGAGAATCAAGCTAACTCGTGCTATTAGACGCCAC
CCTGCGGTCATGAACCACGGCAGCAAGCTGTTTCTGTTTGTGGCTCAGGCTCTCGAAGCAGAGACTCTCCAGGGA
CAAACAGCGACGAGAGTGGCAGCGGCCACCAAGATGCTCCTCACAAGTGCCAGCGTGGACCCGACGCCGCTGCTC
CAGCAATTTTCTCAAGACTCGCAGCGGACTATTATGGGGTACTTCAGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail