Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01772
Gene name
Locationscaffold_02:414687..419267
Strand+
Gene length (bp)4580
Transcript length (bp)4407
Coding sequence length (bp)4407
Protein length (aa) 1469

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18404 Glyco_transf_24 Glucosyltransferase 24 7.2E-149 1163 1429
PF18402 Thioredoxin_14 Thioredoxin-like domain 2.0E-65 394 636
PF18403 Thioredoxin_15 Thioredoxin-like domain 5.8E-55 648 844
PF18400 Thioredoxin_12 Thioredoxin-like domain 6.6E-43 38 214
PF06427 UDP-g_GGTase UDP-glucose:Glycoprotein Glucosyltransferase 1.6E-39 1014 1122
PF18401 Thioredoxin_13 Thioredoxin-like domain 1.1E-37 262 388

GO

GO Term Description Terminal node
GO:0003980 UDP-glucose:glycoprotein glucosyltransferase activity Yes
GO:0006486 protein glycosylation Yes
GO:0044238 primary metabolic process No
GO:0036211 protein modification process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0035251 UDP-glucosyltransferase activity No
GO:0016740 transferase activity No
GO:0043170 macromolecule metabolic process No
GO:0003824 catalytic activity No
GO:0016758 hexosyltransferase activity No
GO:0019538 protein metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0008194 UDP-glycosyltransferase activity No
GO:0046527 glucosyltransferase activity No
GO:0043413 macromolecule glycosylation No
GO:0043412 macromolecule modification No
GO:0070085 glycosylation No
GO:0008150 biological_process No
GO:0016757 glycosyltransferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01772
MARLYRLSWPLYMVVMTGVAVVAVPSVNVGMKAAFSAGPYLLELLETAAAENSTAYFPLIDRIASGYFATASSDA
ELYSKFLDLLVHDGHVAGPEALSTFNLALTLRSAAPRIEAHYQYYSTAVEPSVDPNCLNWVLLEGKQYCTPQLDK
ATREDLFTSGVTTLPFDRTLGSGKEAVLYADPVSESFGDYHKALSKAARARNLQYRVRYRRNEANPHRPLPVSGY
GVELALKRTDYIVIDDREAAVDRSQKPLTPGGFEDEVADLRPLSTSELASLGLKTASFIQNSEKPFTTLIKLTQD
FPRYSASVAAHNISEPFNAAREMVAPGGINFLWMNGVQLIERQIEPFALVEMLRRERRLVDGFRRLGLTGKQAIS
ILGHSAISTAKGDDETLRYDWTDKLEDGRAIIWLNDLENDSRYEDYPKSLVALLQRTFPGQIPQIGQNVFNVIAP
VDLSNTEDIAFLTQIVSLIRRGIPLRFGLVPLTPTTDALAQAKVVLYLKDTLNIDAVFAYLDGLSESKENGVNDQ
LFSKLVADEDSLTDAQRLSSSEIIESDTWADRFKSALHWVKRLKADAAVRPLFINGVFIPRDGNWMQTMSMKISG
DLQNIQKQIFQGSLSEDSESSSIFLRGALSRRNPYISIESDKALRMLDVSRIYSEHGSLFGAIPTLEPYSESTKE
NWAVVTILADLTSVNGRELVLAALEFKRSSPGVRLELVHNPKDLSMAYRVNSALLAQVELVREMETIDQLTKVVN
SVEDESVDDGYAPAVSAFLDMAKIESGKNIIVLNGRIVGPLSADEPFTADDFQQLLEYEQGRRILPVYEAIDDLG
LGDKLTNAMAAAKVTSITALSTISDLPEGIFESAPTMRSTMYDAWDVDHATIEVGDADTASIHIAGLLDPVSEKG
QRWTPILRVLSELDGVYLKIILNPHEKITELPLKRFFRYVMEAKPSFDEKGSVKALRASFEGLPSEVLLTAAMDV
PPAWLVAPKESVHDLDNIKLSSVKSNIDATYELEHILIEGHSREGRGAPPRGAQLTLATEKDPMVTDTIIMSNLG
FFQFKANPGFYKIKLKEGRTADIYMIESIGAQGWEATSGDEGTELALMDFQGTTLYPRLKRRPGMEQKDVLETSD
SASSTGSIVSKGLKLAEELLGGSKTSSKSASAQKHAEINIFSVASGHLYERMLNIMMVSVMRNTKHTVKFWFIEQ
FLSPSFKEFIPYMAREYGFKYEMVTYKWPHWLRQQKEKQREIWGYKILFLDVLFPLSLDKVIFVDADQIVRTDMM
DLVSLDLKGAPYGFTPMCDSRTEMEGFRFWKQGYWSNYLRGRPYHISALYVVDLRRFRELAAGDRLRQQYHALSA
DPASLSNLDQDLPNHMQFEIPIHSLPQEWLWCETWCSDESLAKARTIDLCNNPQTKEPKLDRAKRQVPEWTVYDE
EIAALDRRRKGGDAAESSERHVNTKSRRLDGDSEQNLHTVDEL*
Coding >Ophcf2|01772
ATGGCCCGCCTCTATCGCCTGTCGTGGCCTTTGTATATGGTCGTCATGACAGGAGTGGCCGTCGTCGCAGTTCCA
TCCGTCAACGTTGGCATGAAGGCGGCCTTCTCAGCCGGACCATACTTGCTCGAGCTGCTTGAAACCGCAGCAGCA
GAGAACAGTACCGCCTACTTCCCGCTCATCGACCGAATAGCGAGTGGATACTTTGCCACGGCTTCGTCCGACGCC
GAGTTATACAGCAAGTTTCTCGATCTTCTCGTCCATGACGGCCACGTCGCGGGCCCCGAAGCTCTCTCAACCTTC
AATCTCGCCTTGACACTCCGGTCGGCAGCTCCCCGAATTGAGGCTCATTATCAGTACTACTCGACAGCGGTTGAA
CCATCTGTTGACCCCAATTGCCTGAACTGGGTTCTGCTTGAAGGGAAACAGTATTGCACGCCGCAGCTGGATAAG
GCTACGAGAGAAGATCTCTTCACTTCTGGGGTGACGACGTTACCTTTCGACCGCACCCTGGGATCTGGCAAGGAA
GCCGTCCTCTACGCTGATCCCGTTTCCGAGTCCTTTGGCGACTATCATAAAGCTCTTTCCAAGGCAGCTCGCGCC
CGGAACTTACAATATCGCGTGAGATACCGACGAAATGAGGCGAACCCCCATCGCCCCCTACCTGTGAGCGGTTAC
GGCGTCGAGTTGGCCCTGAAAAGAACAGATTACATCGTCATCGATGACAGGGAAGCCGCTGTTGATCGATCGCAG
AAGCCTCTTACACCTGGTGGTTTCGAGGATGAGGTTGCGGACCTTCGGCCTCTGTCTACATCCGAACTTGCCTCG
CTTGGCCTCAAGACTGCCTCCTTTATCCAAAACAGCGAAAAGCCTTTCACAACGCTTATCAAGCTGACCCAAGAC
TTTCCTCGATACTCGGCTTCGGTTGCTGCCCACAACATATCCGAACCGTTTAACGCCGCGCGCGAAATGGTTGCA
CCCGGGGGGATCAATTTCTTGTGGATGAATGGTGTTCAACTTATCGAGCGTCAGATAGAACCCTTTGCTCTGGTA
GAGATGCTCCGCCGTGAGAGAAGACTGGTAGACGGTTTCCGCCGTCTTGGCTTGACGGGTAAGCAAGCCATCTCG
ATCCTGGGCCACTCAGCCATCTCGACAGCCAAGGGAGACGATGAAACCCTGAGGTACGACTGGACGGATAAGCTG
GAGGACGGGCGAGCAATAATCTGGCTCAACGACCTCGAGAATGATTCTCGTTACGAGGATTATCCCAAGAGTTTA
GTAGCACTGTTGCAACGAACATTTCCTGGACAGATACCTCAAATCGGCCAAAACGTCTTCAACGTCATCGCTCCA
GTTGATCTGTCCAACACCGAAGACATCGCGTTTCTAACTCAGATAGTCTCCCTCATCAGACGCGGTATCCCTCTT
CGATTTGGTCTAGTTCCTTTAACCCCGACCACCGATGCCCTTGCTCAAGCGAAGGTTGTCTTGTACCTGAAAGAC
ACTTTGAACATTGACGCCGTCTTCGCCTATCTTGACGGGCTTAGCGAAAGCAAGGAGAACGGAGTGAACGATCAG
CTATTCTCAAAACTCGTCGCGGACGAAGATTCACTCACAGACGCTCAGCGGTTGTCGTCATCAGAGATTATTGAA
TCCGATACCTGGGCGGATCGGTTTAAGTCGGCCCTCCATTGGGTAAAGAGGCTCAAGGCAGACGCGGCTGTGCGA
CCTCTTTTCATCAACGGCGTCTTTATCCCGCGTGACGGAAACTGGATGCAAACCATGAGCATGAAGATCAGCGGA
GACCTCCAAAACATCCAAAAGCAGATATTCCAGGGAAGTCTTAGTGAAGACTCGGAGAGCTCGAGCATCTTCTTG
AGAGGCGCTCTGTCGAGAAGGAACCCATACATCTCAATCGAAAGTGACAAGGCCCTCCGCATGCTAGACGTCAGT
CGGATCTACAGCGAGCATGGGAGCCTTTTCGGAGCAATTCCCACATTAGAGCCTTATTCAGAGTCGACCAAGGAG
AACTGGGCAGTTGTGACAATTCTGGCCGACCTGACAAGTGTCAATGGCCGGGAGCTCGTACTGGCTGCTTTGGAA
TTCAAGCGCAGCAGCCCCGGCGTGAGGCTCGAGCTCGTTCACAACCCTAAAGACTTGTCAATGGCTTACAGGGTT
AACTCGGCTCTCCTGGCCCAAGTCGAGCTTGTCAGGGAAATGGAGACCATTGATCAGCTAACAAAAGTTGTGAAC
TCGGTTGAGGACGAATCGGTCGATGATGGTTACGCTCCGGCTGTGTCGGCGTTTCTTGACATGGCCAAGATTGAA
TCAGGCAAGAACATCATCGTATTGAACGGCCGGATCGTCGGGCCCCTTTCCGCAGACGAGCCATTCACAGCCGAC
GACTTCCAGCAACTCTTGGAATATGAGCAAGGCCGCCGCATACTCCCCGTCTACGAAGCAATCGATGATCTCGGG
CTGGGCGACAAGCTCACCAACGCCATGGCTGCAGCGAAAGTCACTTCCATCACGGCCCTGTCCACGATATCTGAT
CTCCCAGAGGGAATCTTCGAATCGGCGCCGACGATGCGTTCTACCATGTACGATGCCTGGGACGTGGACCACGCC
ACCATCGAGGTCGGAGATGCCGATACTGCCAGCATTCACATTGCCGGTCTTTTGGATCCCGTCAGCGAAAAGGGG
CAACGATGGACGCCTATCTTGCGGGTTCTGTCGGAACTAGACGGAGTATACTTGAAGATTATACTCAATCCCCAC
GAGAAGATTACCGAGCTCCCGTTGAAGCGATTCTTCAGATACGTCATGGAAGCAAAACCATCGTTCGACGAGAAA
GGCAGCGTCAAAGCCCTCAGGGCAAGCTTCGAGGGTCTGCCGTCGGAAGTGCTGCTGACGGCCGCCATGGACGTC
CCTCCAGCGTGGCTGGTGGCTCCAAAGGAGTCTGTCCACGACCTGGACAACATCAAGTTGAGCTCCGTCAAGTCG
AATATCGACGCCACCTACGAACTTGAACACATACTTATCGAGGGACACTCCCGCGAAGGACGAGGAGCACCACCT
AGAGGGGCGCAACTGACGCTGGCCACGGAGAAGGACCCCATGGTGACGGACACGATCATCATGTCCAACCTCGGC
TTCTTCCAGTTCAAGGCAAACCCTGGCTTCTACAAGATCAAGCTGAAAGAGGGACGCACGGCAGACATCTACATG
ATCGAGAGCATCGGCGCCCAAGGATGGGAGGCCACCTCAGGCGACGAGGGGACCGAGCTGGCCCTGATGGATTTC
CAGGGAACGACGCTGTACCCACGCCTCAAGCGACGGCCCGGGATGGAGCAGAAGGACGTGCTGGAGACGTCCGAC
AGCGCCTCATCCACCGGCAGCATCGTATCCAAGGGCCTCAAGCTCGCCGAAGAGCTACTCGGTGGCTCCAAGACC
AGCAGCAAGTCTGCATCAGCGCAGAAGCACGCCGAGATCAACATCTTTTCCGTCGCCAGCGGCCACCTGTACGAG
CGCATGCTCAACATCATGATGGTATCAGTAATGCGCAACACGAAACACACGGTCAAGTTCTGGTTCATCGAGCAG
TTCCTCTCGCCCTCATTCAAAGAGTTCATCCCCTACATGGCCCGCGAATACGGCTTCAAGTACGAGATGGTAACC
TACAAGTGGCCACACTGGCTACGACAACAAAAGGAAAAGCAGCGCGAAATCTGGGGCTACAAGATCCTCTTCCTC
GACGTCCTCTTCCCCCTCTCCCTCGACAAGGTCATCTTCGTCGACGCGGACCAAATCGTCCGCACCGACATGATG
GACCTGGTCAGCCTCGATCTCAAGGGCGCCCCCTACGGCTTCACGCCCATGTGCGACTCGCGCACCGAGATGGAG
GGCTTCCGCTTCTGGAAGCAAGGCTACTGGTCCAATTACCTCCGCGGCCGACCCTATCACATCTCGGCCCTCTAC
GTCGTCGACCTGCGTCGCTTCAGGGAGCTCGCAGCCGGTGACCGTCTACGACAGCAGTACCACGCCCTCAGCGCC
GATCCCGCCAGTCTCTCCAACCTGGATCAAGACCTGCCCAACCACATGCAGTTCGAGATTCCGATTCATAGCCTG
CCGCAGGAGTGGCTGTGGTGCGAGACGTGGTGTAGCGACGAGAGCCTCGCAAAGGCACGCACCATCGACCTCTGT
AACAATCCGCAGACCAAGGAGCCCAAGCTCGACCGCGCAAAGAGGCAGGTTCCCGAGTGGACCGTCTACGACGAA
GAGATTGCCGCCCTGGACAGGAGGCGGAAGGGCGGCGACGCTGCTGAATCGAGCGAGCGTCATGTCAACACCAAG
AGCCGCAGGCTTGACGGGGATAGCGAGCAGAATCTTCATACTGTAGACGAGCTGTGA
Transcript >Ophcf2|01772
ATGGCCCGCCTCTATCGCCTGTCGTGGCCTTTGTATATGGTCGTCATGACAGGAGTGGCCGTCGTCGCAGTTCCA
TCCGTCAACGTTGGCATGAAGGCGGCCTTCTCAGCCGGACCATACTTGCTCGAGCTGCTTGAAACCGCAGCAGCA
GAGAACAGTACCGCCTACTTCCCGCTCATCGACCGAATAGCGAGTGGATACTTTGCCACGGCTTCGTCCGACGCC
GAGTTATACAGCAAGTTTCTCGATCTTCTCGTCCATGACGGCCACGTCGCGGGCCCCGAAGCTCTCTCAACCTTC
AATCTCGCCTTGACACTCCGGTCGGCAGCTCCCCGAATTGAGGCTCATTATCAGTACTACTCGACAGCGGTTGAA
CCATCTGTTGACCCCAATTGCCTGAACTGGGTTCTGCTTGAAGGGAAACAGTATTGCACGCCGCAGCTGGATAAG
GCTACGAGAGAAGATCTCTTCACTTCTGGGGTGACGACGTTACCTTTCGACCGCACCCTGGGATCTGGCAAGGAA
GCCGTCCTCTACGCTGATCCCGTTTCCGAGTCCTTTGGCGACTATCATAAAGCTCTTTCCAAGGCAGCTCGCGCC
CGGAACTTACAATATCGCGTGAGATACCGACGAAATGAGGCGAACCCCCATCGCCCCCTACCTGTGAGCGGTTAC
GGCGTCGAGTTGGCCCTGAAAAGAACAGATTACATCGTCATCGATGACAGGGAAGCCGCTGTTGATCGATCGCAG
AAGCCTCTTACACCTGGTGGTTTCGAGGATGAGGTTGCGGACCTTCGGCCTCTGTCTACATCCGAACTTGCCTCG
CTTGGCCTCAAGACTGCCTCCTTTATCCAAAACAGCGAAAAGCCTTTCACAACGCTTATCAAGCTGACCCAAGAC
TTTCCTCGATACTCGGCTTCGGTTGCTGCCCACAACATATCCGAACCGTTTAACGCCGCGCGCGAAATGGTTGCA
CCCGGGGGGATCAATTTCTTGTGGATGAATGGTGTTCAACTTATCGAGCGTCAGATAGAACCCTTTGCTCTGGTA
GAGATGCTCCGCCGTGAGAGAAGACTGGTAGACGGTTTCCGCCGTCTTGGCTTGACGGGTAAGCAAGCCATCTCG
ATCCTGGGCCACTCAGCCATCTCGACAGCCAAGGGAGACGATGAAACCCTGAGGTACGACTGGACGGATAAGCTG
GAGGACGGGCGAGCAATAATCTGGCTCAACGACCTCGAGAATGATTCTCGTTACGAGGATTATCCCAAGAGTTTA
GTAGCACTGTTGCAACGAACATTTCCTGGACAGATACCTCAAATCGGCCAAAACGTCTTCAACGTCATCGCTCCA
GTTGATCTGTCCAACACCGAAGACATCGCGTTTCTAACTCAGATAGTCTCCCTCATCAGACGCGGTATCCCTCTT
CGATTTGGTCTAGTTCCTTTAACCCCGACCACCGATGCCCTTGCTCAAGCGAAGGTTGTCTTGTACCTGAAAGAC
ACTTTGAACATTGACGCCGTCTTCGCCTATCTTGACGGGCTTAGCGAAAGCAAGGAGAACGGAGTGAACGATCAG
CTATTCTCAAAACTCGTCGCGGACGAAGATTCACTCACAGACGCTCAGCGGTTGTCGTCATCAGAGATTATTGAA
TCCGATACCTGGGCGGATCGGTTTAAGTCGGCCCTCCATTGGGTAAAGAGGCTCAAGGCAGACGCGGCTGTGCGA
CCTCTTTTCATCAACGGCGTCTTTATCCCGCGTGACGGAAACTGGATGCAAACCATGAGCATGAAGATCAGCGGA
GACCTCCAAAACATCCAAAAGCAGATATTCCAGGGAAGTCTTAGTGAAGACTCGGAGAGCTCGAGCATCTTCTTG
AGAGGCGCTCTGTCGAGAAGGAACCCATACATCTCAATCGAAAGTGACAAGGCCCTCCGCATGCTAGACGTCAGT
CGGATCTACAGCGAGCATGGGAGCCTTTTCGGAGCAATTCCCACATTAGAGCCTTATTCAGAGTCGACCAAGGAG
AACTGGGCAGTTGTGACAATTCTGGCCGACCTGACAAGTGTCAATGGCCGGGAGCTCGTACTGGCTGCTTTGGAA
TTCAAGCGCAGCAGCCCCGGCGTGAGGCTCGAGCTCGTTCACAACCCTAAAGACTTGTCAATGGCTTACAGGGTT
AACTCGGCTCTCCTGGCCCAAGTCGAGCTTGTCAGGGAAATGGAGACCATTGATCAGCTAACAAAAGTTGTGAAC
TCGGTTGAGGACGAATCGGTCGATGATGGTTACGCTCCGGCTGTGTCGGCGTTTCTTGACATGGCCAAGATTGAA
TCAGGCAAGAACATCATCGTATTGAACGGCCGGATCGTCGGGCCCCTTTCCGCAGACGAGCCATTCACAGCCGAC
GACTTCCAGCAACTCTTGGAATATGAGCAAGGCCGCCGCATACTCCCCGTCTACGAAGCAATCGATGATCTCGGG
CTGGGCGACAAGCTCACCAACGCCATGGCTGCAGCGAAAGTCACTTCCATCACGGCCCTGTCCACGATATCTGAT
CTCCCAGAGGGAATCTTCGAATCGGCGCCGACGATGCGTTCTACCATGTACGATGCCTGGGACGTGGACCACGCC
ACCATCGAGGTCGGAGATGCCGATACTGCCAGCATTCACATTGCCGGTCTTTTGGATCCCGTCAGCGAAAAGGGG
CAACGATGGACGCCTATCTTGCGGGTTCTGTCGGAACTAGACGGAGTATACTTGAAGATTATACTCAATCCCCAC
GAGAAGATTACCGAGCTCCCGTTGAAGCGATTCTTCAGATACGTCATGGAAGCAAAACCATCGTTCGACGAGAAA
GGCAGCGTCAAAGCCCTCAGGGCAAGCTTCGAGGGTCTGCCGTCGGAAGTGCTGCTGACGGCCGCCATGGACGTC
CCTCCAGCGTGGCTGGTGGCTCCAAAGGAGTCTGTCCACGACCTGGACAACATCAAGTTGAGCTCCGTCAAGTCG
AATATCGACGCCACCTACGAACTTGAACACATACTTATCGAGGGACACTCCCGCGAAGGACGAGGAGCACCACCT
AGAGGGGCGCAACTGACGCTGGCCACGGAGAAGGACCCCATGGTGACGGACACGATCATCATGTCCAACCTCGGC
TTCTTCCAGTTCAAGGCAAACCCTGGCTTCTACAAGATCAAGCTGAAAGAGGGACGCACGGCAGACATCTACATG
ATCGAGAGCATCGGCGCCCAAGGATGGGAGGCCACCTCAGGCGACGAGGGGACCGAGCTGGCCCTGATGGATTTC
CAGGGAACGACGCTGTACCCACGCCTCAAGCGACGGCCCGGGATGGAGCAGAAGGACGTGCTGGAGACGTCCGAC
AGCGCCTCATCCACCGGCAGCATCGTATCCAAGGGCCTCAAGCTCGCCGAAGAGCTACTCGGTGGCTCCAAGACC
AGCAGCAAGTCTGCATCAGCGCAGAAGCACGCCGAGATCAACATCTTTTCCGTCGCCAGCGGCCACCTGTACGAG
CGCATGCTCAACATCATGATGGTATCAGTAATGCGCAACACGAAACACACGGTCAAGTTCTGGTTCATCGAGCAG
TTCCTCTCGCCCTCATTCAAAGAGTTCATCCCCTACATGGCCCGCGAATACGGCTTCAAGTACGAGATGGTAACC
TACAAGTGGCCACACTGGCTACGACAACAAAAGGAAAAGCAGCGCGAAATCTGGGGCTACAAGATCCTCTTCCTC
GACGTCCTCTTCCCCCTCTCCCTCGACAAGGTCATCTTCGTCGACGCGGACCAAATCGTCCGCACCGACATGATG
GACCTGGTCAGCCTCGATCTCAAGGGCGCCCCCTACGGCTTCACGCCCATGTGCGACTCGCGCACCGAGATGGAG
GGCTTCCGCTTCTGGAAGCAAGGCTACTGGTCCAATTACCTCCGCGGCCGACCCTATCACATCTCGGCCCTCTAC
GTCGTCGACCTGCGTCGCTTCAGGGAGCTCGCAGCCGGTGACCGTCTACGACAGCAGTACCACGCCCTCAGCGCC
GATCCCGCCAGTCTCTCCAACCTGGATCAAGACCTGCCCAACCACATGCAGTTCGAGATTCCGATTCATAGCCTG
CCGCAGGAGTGGCTGTGGTGCGAGACGTGGTGTAGCGACGAGAGCCTCGCAAAGGCACGCACCATCGACCTCTGT
AACAATCCGCAGACCAAGGAGCCCAAGCTCGACCGCGCAAAGAGGCAGGTTCCCGAGTGGACCGTCTACGACGAA
GAGATTGCCGCCCTGGACAGGAGGCGGAAGGGCGGCGACGCTGCTGAATCGAGCGAGCGTCATGTCAACACCAAG
AGCCGCAGGCTTGACGGGGATAGCGAGCAGAATCTTCATACTGTAGACGAGCTGTGA
Gene >Ophcf2|01772
ATGGCCCGCCTCTATCGCCTGTCGTGGCCTTTGTATATGGTCGTCATGACAGGAGTGGCCGTCGTCGCAGTTCCA
TCCGTCAACGTTGGCATGAAGGCGGCCTTCTCAGCCGGACCATACTTGCTCGAGCTGCTGTACGTCCGCTCCCAT
GATACCGATAGATGAGATGCAGGCGCTGATACAGCACCAGTGAAACCGCAGCAGCAGAGAACAGTACCGCCTACT
TCCCGCTCATCGACCGAATAGCGAGTGGATACTTTGCCACGGCTTCGTCCGACGCCGAGTTATACAGCAAGTTTC
TCGATCTTCTCGTCCATGACGGCCACGTCGCGGGCCCCGAAGCTCTCTCAACCTTCAATCTCGCCTTGACACTCC
GGTCGGCAGCTCCCCGAATTGAGGCTCATTATCAGTACTACTCGACAGCGGTTGAACCATCTGTTGACCCCAATT
GCCTGAACTGGGTTCTGCTTGAAGGGAAACAGTATTGCACGCCGCAGCTGGATAAGGCTACGAGAGAAGATCTCT
TCACTTCGTAAGTTGATCAAGACGGTGGATGTATTATTCCGTCGCATCGTTCTGACTCAATCTCGGATGCAGTGG
GGTGACGACGTTACCTTTCGACCGCACCCTGGGATCTGGCAAGGAAGCCGTCCTCTACGCTGATCCCGTTTCCGA
GTCCTTTGGCGACTATCATAAAGCTCTTTCCAAGGCAGCTCGCGCCCGGAACTTACAATATCGCGTGAGATACCG
ACGAAATGAGGCGAACCCCCATCGCCCCCTACCTGTGAGCGGTTACGGCGTCGAGTTGGCCCTGAAAAGAACAGA
TTACATCGTCATCGATGACAGGGAAGCCGCTGTTGATCGATCGCAGAAGCCTCTTACACCTGGTGGTTTCGAGGA
TGAGGTTGCGGACCTTCGGCCTCTGTCTACATCCGAACTTGCCTCGCTTGGCCTCAAGACTGCCTCCTTTATCCA
AAACAGCGAAAAGCCTTTCACAACGCTTATCAAGCTGACCCAAGACTTTCCTCGATACTCGGCTTCGGTTGCTGC
CCACAACATATCCGAACCGTTTAACGCCGCGCGCGAAATGGTTGCACCCGGGGGGATCAATTTCTTGTGGATGAA
TGGTGTTCAACTTATCGAGCGTCAGATAGAACCCTTTGCTCTGGTAGAGATGCTCCGCCGTGAGAGAAGACTGGT
AGACGGTTTCCGCCGTCTTGGCTTGACGGGTAAGCAAGCCATCTCGATCCTGGGCCACTCAGCCATCTCGACAGC
CAAGGGAGACGATGAAACCCTGAGGTACGACTGGACGGATAAGCTGGAGGACGGGCGAGCAATAATCTGGCTCAA
CGACCTCGAGAATGATTCTCGTTACGAGGATTATCCCAAGAGTTTAGTAGCAGTAAGTTTGCTGTCGCTAGGTTG
GCTTTTACTTCAACTCATCGATGATATAGCTGTTGCAACGAACATTTCCTGGACAGATACCTCAAATCGGCCAAA
ACGTCTTCAACGTCATCGCTCCAGTTGATCTGTCCAACACCGAAGACATCGCGTTTCTAACTCAGATAGTCTCCC
TCATCAGACGCGGTATCCCTCTTCGATTTGGTCTAGTTCCTTTAACCCCGACCACCGATGCCCTTGCTCAAGCGA
AGGTTGTCTTGTACCTGAAAGACACTTTGAACATTGACGCCGTCTTCGCCTATCTTGACGGGCTTAGCGAAAGCA
AGGAGAACGGAGTGAACGATCAGCTATTCTCAAAACTCGTCGCGGACGAAGATTCACTCACAGACGCTCAGCGGT
TGTCGTCATCAGAGATTATTGAATCCGATACCTGGGCGGATCGGTTTAAGTCGGCCCTCCATTGGGTAAAGAGGC
TCAAGGCAGACGCGGCTGTGCGACCTCTTTTCATCAACGGCGTCTTTATCCCGCGTGACGGAAACTGGATGCAAA
CCATGAGCATGAAGATCAGCGGAGACCTCCAAAACATCCAAAAGCAGATATTCCAGGGAAGTCTTAGTGAAGACT
CGGAGAGCTCGAGCATCTTCTTGAGAGGCGCTCTGTCGAGAAGGAACCCATACATCTCAATCGAAAGTGACAAGG
CCCTCCGCATGCTAGACGTCAGTCGGATCTACAGCGAGCATGGGAGCCTTTTCGGAGCAATTCCCACATTAGAGC
CTTATTCAGAGTCGACCAAGGAGAACTGGGCAGTTGTGACAATTCTGGCCGACCTGACAAGTGTCAATGGCCGGG
AGCTCGTACTGGCTGCTTTGGAATTCAAGCGCAGCAGCCCCGGCGTGAGGCTCGAGCTCGTTCACAACCCTAAAG
ACTTGTCAATGGCTTACAGGGTTAACTCGGCTCTCCTGGCCCAAGTCGAGCTTGTCAGGGAAATGGAGACCATTG
ATCAGCTAACAAAAGTTGTGAACTCGGTTGAGGACGAATCGGTCGATGATGGTTACGCTCCGGCTGTGTCGGCGT
TTCTTGACATGGCCAAGATTGAATCAGGCAAGAACATCATCGTATTGAACGGCCGGATCGTCGGGCCCCTTTCCG
CAGACGAGCCATTCACAGCCGACGACTTCCAGCAACTCTTGGAATATGAGCAAGGCCGCCGCATACTCCCCGTCT
ACGAAGCAATCGATGATCTCGGGCTGGGCGACAAGCTCACCAACGCCATGGCTGCAGCGAAAGTCACTTCCATCA
CGGCCCTGTCCACGATATCTGATCTCCCAGAGGGAATCTTCGAATCGGCGCCGACGATGCGTTCTACCATGTACG
ATGCCTGGGACGTGGACCACGCCACCATCGAGGTCGGAGATGCCGATACTGCCAGCATTCACATTGCCGGTCTTT
TGGATCCCGTCAGCGAAAAGGGGCAACGATGGACGCCTATCTTGCGGGTTCTGTCGGAACTAGACGGAGTATACT
TGAAGATTATACTCAATCCCCACGAGAAGATTACCGAGCTCCCGTTGAAGCGATTCTTCAGATACGTCATGGAAG
CAAAACCATCGTTCGACGAGAAAGGCAGCGTCAAAGCCCTCAGGGCAAGCTTCGAGGGTCTGCCGTCGGAAGTGC
TGCTGACGGCCGCCATGGACGTCCCTCCAGCGTGGCTGGTGGCTCCAAAGGAGTCTGTCCACGACCTGGACAACA
TCAAGTTGAGCTCCGTCAAGTCGAATATCGACGCCACCTACGAACTTGAACACATACTTATCGAGGGACACTCCC
GCGAAGGACGAGGAGCACCACCTAGAGGGGCGCAACTGACGCTGGCCACGGAGAAGGACCCCATGGTGACGGACA
CGATCATCATGTCCAACCTCGGCTTCTTCCAGTTCAAGGCAAACCCTGGCTTCTACAAGATCAAGCTGAAAGAGG
GACGCACGGCAGACATCTACATGATCGAGAGCATCGGCGCCCAAGGATGGGAGGCCACCTCAGGCGACGAGGGGA
CCGAGCTGGCCCTGATGGATTTCCAGGGAACGACGCTGTACCCACGCCTCAAGCGACGGCCCGGGATGGAGCAGA
AGGACGTGCTGGAGACGTCCGACAGCGCCTCATCCACCGGCAGCATCGTATCCAAGGGCCTCAAGCTCGCCGAAG
AGCTACTCGGTGGCTCCAAGACCAGCAGCAAGTCTGCATCAGCGCAGAAGCACGCCGAGATCAACATCTTTTCCG
TCGCCAGCGGCCACCTGTACGAGCGCATGCTCAACATCATGATGGTATCAGTAATGCGCAACACGAAACACACGG
TCAAGTTCTGGTTCATCGAGCAGTTCCTCTCGCCCTCATTCAAAGAGTTCATCCCCTACATGGCCCGCGAATACG
GCTTCAAGTACGAGATGGTAACCTACAAGTGGCCACACTGGCTACGACAACAAAAGGAAAAGCAGCGCGAAATCT
GGGGCTACAAGATCCTCTTCCTCGACGTCCTCTTCCCCCTCTCCCTCGACAAGGTCATCTTCGTCGACGCGGACC
AAATCGTCCGCACCGACATGATGGACCTGGTCAGCCTCGATCTCAAGGGCGCCCCCTACGGCTTCACGCCCATGT
GCGACTCGCGCACCGAGATGGAGGGCTTCCGCTTCTGGAAGCAAGGCTACTGGTCCAATTACCTCCGCGGCCGAC
CCTATCACATCTCGGCCCTCTACGTCGTCGACCTGCGTCGCTTCAGGGAGCTCGCAGCCGGTGACCGTCTACGAC
AGCAGTACCACGCCCTCAGCGCCGATCCCGCCAGTCTCTCCAACCTGGATCAAGACCTGCCCAACCACATGCAGT
TCGAGATTCCGATTCATAGCCTGCCGCAGGAGTGGCTGTGGTGCGAGACGTGGTGTAGCGACGAGAGCCTCGCAA
AGGCACGCACCATCGACCTCTGTAACAATCCGCAGACCAAGGAGCCCAAGCTCGACCGCGCAAAGAGGCAGGTTC
CCGAGTGGACCGTCTACGACGAAGAGATTGCCGCCCTGGACAGGAGGCGGAAGGGCGGCGACGCTGCTGAATCGA
GCGAGCGTCATGTCAACACCAAGAGCCGCAGGCTTGACGGGGATAGCGAGCAGAATCTTCATACTGTAGACGAGC
TGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail