Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01770
Gene name
Locationscaffold_02:408692..409569
Strand+
Gene length (bp)877
Transcript length (bp)822
Coding sequence length (bp)822
Protein length (aa) 274

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10075 CSN8_PSD8_EIF3K CSN8/PSMD8/EIF3K family 4.7E-21 102 240

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear export signal 0.7618 0.6748 0.0528 0.1168 0.0393 0.0053 0.1472 0.4339 0.3608 0.0075

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5008
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|544
Ophiocordyceps australis map64 (Brazil) OphauB2|4819
Ophiocordyceps camponoti-floridani Ophcf2|01770 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|915
Ophiocordyceps kimflemingae Ophio5|4970
Ophiocordyceps subramaniannii Hirsu2|2421

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01770
MAERNLTQILGQLKNSPSMNYPEANRLLSQAKLAILQLKALTPTPSVSSHLLALARETYEQGALFAIRARQPEAF
TRYVQQLQPFYELPSARLPPNLAERNKITGLSLLLLLTQGRYAEFHSELESLANRDGGGSPGDVEGDSYLGYPIR
LERWLMEGSYDRVWKAMKSSEVPCDEYSVFSEILKNQIRSEIAASSERAYLSIPLSSTKSLLFLDSEGEVIQFAK
HRGWAVRNGHIFFPEAADTDEDGGLSKDFSQMIIENTLGYARELETIV*
Coding >Ophcf2|01770
ATGGCGGAACGCAACCTCACCCAGATCCTGGGCCAGCTCAAGAATTCGCCGTCAATGAACTACCCCGAAGCCAAC
AGACTCCTCTCGCAGGCTAAGCTCGCCATCCTCCAGCTCAAGGCCCTCACCCCGACGCCATCCGTCTCGTCTCAT
CTTCTCGCTCTCGCCCGTGAGACGTACGAGCAGGGTGCCCTCTTTGCCATCCGCGCACGTCAACCCGAGGCCTTC
ACCCGCTACGTTCAACAGCTCCAGCCCTTTTACGAACTGCCCTCCGCGAGGCTACCCCCGAATCTTGCCGAGCGC
AATAAAATCACCGGTCTCAGTCTCCTGCTTCTTCTGACCCAGGGGCGCTACGCCGAATTCCACTCCGAGCTCGAG
AGTCTTGCCAACAGGGATGGTGGCGGCAGCCCCGGAGATGTCGAGGGAGACAGCTACCTCGGATATCCCATCAGG
CTGGAGCGCTGGTTAATGGAAGGTAGCTATGATCGAGTCTGGAAGGCAATGAAGAGCAGCGAGGTGCCCTGCGAT
GAGTACAGTGTCTTCTCCGAAATCCTCAAGAACCAAATCCGCTCCGAGATTGCCGCCAGCAGCGAACGAGCCTAT
CTCAGCATCCCCTTAAGCTCCACAAAGTCTCTCCTCTTCCTCGACTCCGAGGGCGAAGTCATACAGTTTGCTAAG
CACCGCGGATGGGCTGTCCGGAATGGCCACATCTTCTTCCCCGAAGCCGCCGACACCGACGAGGATGGCGGTCTC
AGCAAGGACTTTAGCCAGATGATTATCGAAAACACTCTGGGCTATGCACGCGAGCTCGAGACTATCGTCTAA
Transcript >Ophcf2|01770
ATGGCGGAACGCAACCTCACCCAGATCCTGGGCCAGCTCAAGAATTCGCCGTCAATGAACTACCCCGAAGCCAAC
AGACTCCTCTCGCAGGCTAAGCTCGCCATCCTCCAGCTCAAGGCCCTCACCCCGACGCCATCCGTCTCGTCTCAT
CTTCTCGCTCTCGCCCGTGAGACGTACGAGCAGGGTGCCCTCTTTGCCATCCGCGCACGTCAACCCGAGGCCTTC
ACCCGCTACGTTCAACAGCTCCAGCCCTTTTACGAACTGCCCTCCGCGAGGCTACCCCCGAATCTTGCCGAGCGC
AATAAAATCACCGGTCTCAGTCTCCTGCTTCTTCTGACCCAGGGGCGCTACGCCGAATTCCACTCCGAGCTCGAG
AGTCTTGCCAACAGGGATGGTGGCGGCAGCCCCGGAGATGTCGAGGGAGACAGCTACCTCGGATATCCCATCAGG
CTGGAGCGCTGGTTAATGGAAGGTAGCTATGATCGAGTCTGGAAGGCAATGAAGAGCAGCGAGGTGCCCTGCGAT
GAGTACAGTGTCTTCTCCGAAATCCTCAAGAACCAAATCCGCTCCGAGATTGCCGCCAGCAGCGAACGAGCCTAT
CTCAGCATCCCCTTAAGCTCCACAAAGTCTCTCCTCTTCCTCGACTCCGAGGGCGAAGTCATACAGTTTGCTAAG
CACCGCGGATGGGCTGTCCGGAATGGCCACATCTTCTTCCCCGAAGCCGCCGACACCGACGAGGATGGCGGTCTC
AGCAAGGACTTTAGCCAGATGATTATCGAAAACACTCTGGGCTATGCACGCGAGCTCGAGACTATCGTCTAA
Gene >Ophcf2|01770
ATGGCGGAACGCAACCTCACCCAGATCCTGGGCCAGCTCAAGAATTCGCCGTCAATGAACTACCCCGAAGCCAAC
AGACTCCTCTCGCAGGCTAAGCTCGCCATCCTCCAGCTCAAGGCCCTCACCCCGACGCCATCCGTCTCGTCTCAT
CTTCTCGCTCTCGCCCGTGAGACGTACGAGCAGGGTGCCCTCTTTGCCATCCGCGCACGTCAACCCGAGGCCTTC
ACCCGCTACGTTCAACAGCTCCAGCCCTTTTACGAACTGCCCTCCGCGAGGCTACCCCCGAATCTTGCCGAGCGC
AATAAAATCACCGGTCTCAGTCTCCTGCTTCTTCTGACCCAGGGGCGCTACGCCGAATTCCACTCCGAGCTCGAG
AGTCTTGCCAACAGGGATGGTGGCGGCAGCCCCGGAGATGTCGAGGGAGACAGCTACCTCGGATATCCCATCAGG
CTGGAGCGCTGGTTAATGGAAGGTAGCTATGATCGAGTCTGGAAGGCAATGAAGAGCAGCGAGGTGCCCTGCGAT
GAGTACAGTGTCTTCTCCGAAGTTAGTCGGCATCCCTTGAGCTCTGCGTCTGTGCCAGTCTCTAACCTCGTCACA
GATCCTCAAGAACCAAATCCGCTCCGAGATTGCCGCCAGCAGCGAACGAGCCTATCTCAGCATCCCCTTAAGCTC
CACAAAGTCTCTCCTCTTCCTCGACTCCGAGGGCGAAGTCATACAGTTTGCTAAGCACCGCGGATGGGCTGTCCG
GAATGGCCACATCTTCTTCCCCGAAGCCGCCGACACCGACGAGGATGGCGGTCTCAGCAAGGACTTTAGCCAGAT
GATTATCGAAAACACTCTGGGCTATGCACGCGAGCTCGAGACTATCGTCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail