Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01769
Gene name
Locationscaffold_02:404937..408149
Strand-
Gene length (bp)3212
Transcript length (bp)2694
Coding sequence length (bp)2694
Protein length (aa) 898

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08238 Sel1 Sel1 repeat 1.9E+01 263 299
PF08238 Sel1 Sel1 repeat 2.6E+02 301 325
PF08238 Sel1 Sel1 repeat 7.4E-01 332 358
PF08238 Sel1 Sel1 repeat 1.9E-01 454 486
PF08238 Sel1 Sel1 repeat 1.1E-04 494 526

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6877 0.31 0.0653 0.3456 0.2204 0.03 0.1847 0.2231 0.2417 0.096

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5790
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1756
Ophiocordyceps australis map64 (Brazil) OphauB2|4891
Ophiocordyceps camponoti-floridani Ophcf2|01769 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1006
Ophiocordyceps kimflemingae Ophio5|4969
Ophiocordyceps subramaniannii Hirsu2|9772

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01769
MCSCHIHTALRIGPTRGYGERPASWPRFLGPEQRFPESQPQPQPQPHQKTKVLLGETWCFGSERRRHSSIDAMPP
QLSATFVPSGQDDYYLPEVVAPSPQRVTPQLPQTMQEDLQRLELGDGQSSEGASRRGPSSTRIADSRPGRAPETP
SVDSYSSSPRLDSMDADAPSFSPFPKVSGDNIPPADDAKEGILWNARKHVLHSQNVSMQMSWARDALVWVDIAAD
AAARDSADKPRPDTPRIEHELREDALNIVNYLARQEYPEALYVRSKWLEFGKFGNRVDKREAYNGYKRAADLGHA
RSEYRLGMLFEQSNDMSKAKEHYYKGMSLKDSASLYRMGMMSLLGQHGESKDYPRGLERIQAAADSSDEDAPQGS
YVYGMLVGRDLPDITIPDGLLPYSLETAKMYVEKAAYLGFAKAQLKMGQAYELCQLACEFHPSYSLHYYGLAARQ
GLPEAALGVSRWFLFGYEGVFKKNEELAFKYAQEAALAKLPTGEFAMGYYYEIGIHVNKSIEDARKWYQLAAEHG
NKDAQSRLDSLSQDKSLSKRDHETTTLTRIKSQHGSQRGKRPERFKQPQQMPTLNESGASPTLDNEARKAALAAS
STTDSPRMSPQPSLGVRPTIVSESASFPDPSRASVVSADRQSAFGIRPDVARPRSAAPYPSDDGPISNRSRSTAP
YPEDDMAVGPNMYPNMASHSPYADRPISAFAGKAPATGPRPMPMSHSVGSLQPQPAPSSQGSRIASAGFMRTGPG
GNRHGSPSPGQAGGRPYPPDNPQQGRSPSTQPYPSGNRLQKQNDIRVSGQGQERLSRVPGATGRPERLGSAPPQD
PQRPARMSPSPAQTPSRPGMGRIGSAPSAAILSTSTSHSSAGSSSAKPKQGPATFEDMGIPQGKQEGDCVVM*
Coding >Ophcf2|01769
ATGTGCAGCTGTCATATTCATACGGCTCTCAGGATTGGTCCCACTCGTGGATACGGGGAGCGGCCCGCCTCTTGG
CCGAGATTTCTTGGCCCCGAGCAAAGATTCCCTGAAAGCCAGCCGCAGCCGCAGCCGCAGCCGCATCAGAAGACC
AAAGTTCTTCTCGGTGAAACTTGGTGCTTCGGGAGCGAACGCCGTCGACACTCATCCATCGACGCAATGCCTCCT
CAGCTCAGTGCCACGTTCGTTCCCAGCGGCCAGGACGATTACTATTTACCAGAGGTGGTCGCGCCGTCGCCCCAG
AGGGTGACTCCTCAATTACCCCAGACCATGCAAGAGGATCTCCAGCGCCTCGAGCTCGGTGACGGACAATCTTCC
GAGGGCGCGTCTCGTCGCGGCCCATCGTCAACAAGAATCGCCGACTCGAGGCCTGGACGAGCCCCTGAGACGCCA
TCTGTCGACTCCTACAGCAGCAGCCCCCGGCTCGACAGCATGGATGCCGACGCTCCCTCCTTTTCTCCTTTTCCA
AAGGTCTCGGGCGATAACATACCCCCGGCCGACGACGCCAAGGAGGGCATCCTGTGGAACGCGCGCAAGCACGTG
CTGCACTCTCAGAATGTCTCGATGCAGATGAGCTGGGCTCGCGATGCCCTCGTCTGGGTCGACATAGCTGCAGAC
GCCGCCGCTCGCGACTCAGCCGACAAGCCCCGTCCCGACACCCCGCGCATCGAGCACGAGCTGCGCGAAGACGCC
TTGAACATTGTCAACTACCTGGCCCGTCAGGAGTACCCGGAGGCCCTCTATGTTCGCTCCAAATGGCTCGAGTTC
GGCAAGTTCGGCAACCGCGTCGACAAGCGAGAGGCCTACAACGGGTACAAACGTGCCGCCGACCTGGGCCACGCC
CGCTCCGAGTACCGCCTGGGTATGCTGTTTGAGCAGTCAAACGACATGTCCAAGGCCAAGGAGCACTACTACAAG
GGCATGAGCTTGAAGGACTCGGCATCCCTCTATCGCATGGGCATGATGAGCCTGCTCGGCCAGCACGGCGAATCC
AAGGACTACCCCCGAGGCCTCGAACGAATTCAGGCGGCCGCCGACAGCTCCGACGAGGACGCGCCCCAAGGCTCG
TACGTCTACGGCATGCTGGTAGGCAGAGACCTTCCCGACATCACCATCCCCGACGGCCTCCTGCCCTACAGCCTG
GAGACGGCCAAGATGTACGTCGAAAAGGCCGCCTATCTCGGCTTTGCCAAGGCTCAGCTCAAGATGGGCCAGGCC
TACGAGCTCTGCCAGCTCGCCTGCGAATTCCATCCGTCCTACTCCCTTCACTACTACGGACTCGCCGCCAGACAG
GGCCTTCCAGAGGCCGCACTCGGCGTCAGCCGCTGGTTTCTCTTTGGATACGAGGGCGTCTTCAAGAAGAATGAG
GAGCTCGCCTTCAAGTACGCCCAAGAGGCTGCCCTGGCCAAGCTGCCGACGGGAGAATTCGCCATGGGCTACTAC
TACGAGATTGGCATCCACGTCAATAAGAGTATCGAAGACGCCCGGAAGTGGTATCAGCTTGCGGCCGAACACGGC
AACAAAGACGCGCAGAGTCGCCTAGACTCGCTGAGCCAAGACAAGAGCCTGTCGAAGAGGGACCACGAGACGACG
ACGTTGACGCGCATCAAGTCCCAGCACGGTTCGCAACGGGGCAAGCGACCCGAACGGTTCAAGCAGCCTCAGCAG
ATGCCGACGCTGAACGAGAGCGGCGCGTCCCCCACGCTCGACAACGAGGCGCGGAAGGCGGCTTTGGCGGCATCG
TCAACGACCGACTCCCCACGCATGTCGCCTCAACCGTCCCTGGGCGTCAGGCCCACCATTGTATCCGAGAGCGCC
TCCTTCCCGGATCCCTCGAGGGCTTCTGTGGTGAGCGCCGACCGACAGTCGGCCTTTGGCATCCGGCCGGACGTT
GCGCGTCCGCGTTCCGCAGCGCCGTACCCTTCGGACGACGGGCCGATATCGAACCGGTCGCGATCTACGGCGCCG
TATCCGGAAGACGACATGGCCGTCGGGCCCAACATGTATCCCAACATGGCGTCTCACTCGCCTTACGCCGACCGG
CCCATCAGCGCTTTCGCCGGCAAGGCGCCTGCCACGGGCCCGCGTCCCATGCCCATGTCACACAGCGTGGGCAGC
CTCCAGCCGCAGCCGGCTCCCTCGTCCCAGGGGAGCAGGATCGCCTCTGCCGGCTTTATGCGTACCGGTCCGGGA
GGAAATCGACATGGGAGCCCGAGCCCGGGTCAGGCTGGCGGTCGCCCTTATCCTCCCGACAACCCACAACAGGGT
CGGTCCCCGAGCACGCAGCCGTATCCCAGCGGCAACAGGTTGCAGAAGCAAAACGACATCCGCGTGTCCGGCCAG
GGTCAGGAGCGGCTTTCGAGAGTTCCCGGCGCGACGGGCAGGCCGGAGCGGCTCGGCTCGGCTCCCCCGCAGGAT
CCACAGAGACCGGCTCGGATGTCGCCCAGCCCGGCGCAGACTCCTTCGAGGCCGGGAATGGGAAGGATCGGCAGC
GCCCCCTCGGCAGCGATTCTCTCTACGTCGACTTCTCACAGCTCGGCAGGCTCGTCGTCGGCCAAGCCGAAACAG
GGCCCTGCGACGTTTGAAGACATGGGAATTCCACAGGGAAAGCAGGAAGGCGATTGTGTTGTCATGTGA
Transcript >Ophcf2|01769
ATGTGCAGCTGTCATATTCATACGGCTCTCAGGATTGGTCCCACTCGTGGATACGGGGAGCGGCCCGCCTCTTGG
CCGAGATTTCTTGGCCCCGAGCAAAGATTCCCTGAAAGCCAGCCGCAGCCGCAGCCGCAGCCGCATCAGAAGACC
AAAGTTCTTCTCGGTGAAACTTGGTGCTTCGGGAGCGAACGCCGTCGACACTCATCCATCGACGCAATGCCTCCT
CAGCTCAGTGCCACGTTCGTTCCCAGCGGCCAGGACGATTACTATTTACCAGAGGTGGTCGCGCCGTCGCCCCAG
AGGGTGACTCCTCAATTACCCCAGACCATGCAAGAGGATCTCCAGCGCCTCGAGCTCGGTGACGGACAATCTTCC
GAGGGCGCGTCTCGTCGCGGCCCATCGTCAACAAGAATCGCCGACTCGAGGCCTGGACGAGCCCCTGAGACGCCA
TCTGTCGACTCCTACAGCAGCAGCCCCCGGCTCGACAGCATGGATGCCGACGCTCCCTCCTTTTCTCCTTTTCCA
AAGGTCTCGGGCGATAACATACCCCCGGCCGACGACGCCAAGGAGGGCATCCTGTGGAACGCGCGCAAGCACGTG
CTGCACTCTCAGAATGTCTCGATGCAGATGAGCTGGGCTCGCGATGCCCTCGTCTGGGTCGACATAGCTGCAGAC
GCCGCCGCTCGCGACTCAGCCGACAAGCCCCGTCCCGACACCCCGCGCATCGAGCACGAGCTGCGCGAAGACGCC
TTGAACATTGTCAACTACCTGGCCCGTCAGGAGTACCCGGAGGCCCTCTATGTTCGCTCCAAATGGCTCGAGTTC
GGCAAGTTCGGCAACCGCGTCGACAAGCGAGAGGCCTACAACGGGTACAAACGTGCCGCCGACCTGGGCCACGCC
CGCTCCGAGTACCGCCTGGGTATGCTGTTTGAGCAGTCAAACGACATGTCCAAGGCCAAGGAGCACTACTACAAG
GGCATGAGCTTGAAGGACTCGGCATCCCTCTATCGCATGGGCATGATGAGCCTGCTCGGCCAGCACGGCGAATCC
AAGGACTACCCCCGAGGCCTCGAACGAATTCAGGCGGCCGCCGACAGCTCCGACGAGGACGCGCCCCAAGGCTCG
TACGTCTACGGCATGCTGGTAGGCAGAGACCTTCCCGACATCACCATCCCCGACGGCCTCCTGCCCTACAGCCTG
GAGACGGCCAAGATGTACGTCGAAAAGGCCGCCTATCTCGGCTTTGCCAAGGCTCAGCTCAAGATGGGCCAGGCC
TACGAGCTCTGCCAGCTCGCCTGCGAATTCCATCCGTCCTACTCCCTTCACTACTACGGACTCGCCGCCAGACAG
GGCCTTCCAGAGGCCGCACTCGGCGTCAGCCGCTGGTTTCTCTTTGGATACGAGGGCGTCTTCAAGAAGAATGAG
GAGCTCGCCTTCAAGTACGCCCAAGAGGCTGCCCTGGCCAAGCTGCCGACGGGAGAATTCGCCATGGGCTACTAC
TACGAGATTGGCATCCACGTCAATAAGAGTATCGAAGACGCCCGGAAGTGGTATCAGCTTGCGGCCGAACACGGC
AACAAAGACGCGCAGAGTCGCCTAGACTCGCTGAGCCAAGACAAGAGCCTGTCGAAGAGGGACCACGAGACGACG
ACGTTGACGCGCATCAAGTCCCAGCACGGTTCGCAACGGGGCAAGCGACCCGAACGGTTCAAGCAGCCTCAGCAG
ATGCCGACGCTGAACGAGAGCGGCGCGTCCCCCACGCTCGACAACGAGGCGCGGAAGGCGGCTTTGGCGGCATCG
TCAACGACCGACTCCCCACGCATGTCGCCTCAACCGTCCCTGGGCGTCAGGCCCACCATTGTATCCGAGAGCGCC
TCCTTCCCGGATCCCTCGAGGGCTTCTGTGGTGAGCGCCGACCGACAGTCGGCCTTTGGCATCCGGCCGGACGTT
GCGCGTCCGCGTTCCGCAGCGCCGTACCCTTCGGACGACGGGCCGATATCGAACCGGTCGCGATCTACGGCGCCG
TATCCGGAAGACGACATGGCCGTCGGGCCCAACATGTATCCCAACATGGCGTCTCACTCGCCTTACGCCGACCGG
CCCATCAGCGCTTTCGCCGGCAAGGCGCCTGCCACGGGCCCGCGTCCCATGCCCATGTCACACAGCGTGGGCAGC
CTCCAGCCGCAGCCGGCTCCCTCGTCCCAGGGGAGCAGGATCGCCTCTGCCGGCTTTATGCGTACCGGTCCGGGA
GGAAATCGACATGGGAGCCCGAGCCCGGGTCAGGCTGGCGGTCGCCCTTATCCTCCCGACAACCCACAACAGGGT
CGGTCCCCGAGCACGCAGCCGTATCCCAGCGGCAACAGGTTGCAGAAGCAAAACGACATCCGCGTGTCCGGCCAG
GGTCAGGAGCGGCTTTCGAGAGTTCCCGGCGCGACGGGCAGGCCGGAGCGGCTCGGCTCGGCTCCCCCGCAGGAT
CCACAGAGACCGGCTCGGATGTCGCCCAGCCCGGCGCAGACTCCTTCGAGGCCGGGAATGGGAAGGATCGGCAGC
GCCCCCTCGGCAGCGATTCTCTCTACGTCGACTTCTCACAGCTCGGCAGGCTCGTCGTCGGCCAAGCCGAAACAG
GGCCCTGCGACGTTTGAAGACATGGGAATTCCACAGGGAAAGCAGGAAGGCGATTGTGTTGTCATGTGA
Gene >Ophcf2|01769
ATGTGCAGCTGTCATATTCATACGGTAAAGGCACAATCTGCTGACTGGGCGGCTCGGCTGCCTTACCTGAGACCT
CACAGGCTCTCAGGCTCTCAGGTTCTCAGGGCTCGCAGACCATCAGGCTATAAGGGCTCTCAAAAAATCCAAGGA
TTGGTCCCACTCGTGGATACGGGGAGCGGCCCGCCTCTTGGCCGAGATTTCTTGGCCCCGAGCAAAGATTCCCTG
AAAGGTCAGCGTTCGTCTCATCTCCTTTCTCCCTCCAACCTGGTCGACCTGGTCAAGCTCGTCGGTCTCTCAGCC
GCTGTGGTCTCTGTCGCTCCCGCTGTCGCTCTCTTCTTACATCTTACAGCCAGCCGCAGCCGCAGCCGCAGCCGC
ATCAGAAGACCAAAGTTCTTCTCGGTGAAACTTGGTGCTTCGGGAGCGAACGCCGTCGACACTCATCCATCGACG
CAATGCCTCCTCAGCTCAGTGCCACGTTCGTTCCCAGCGGCCAGGACGATTACTATTTACCAGAGGTGGTCGCGC
CGTCGCCCCAGAGGTAGGTTAGACGGGCAACTTGGTCCAACTACCATCAACTACCTACCTGCCCAACTACCTACC
CACCTACCTTCTCTACCTACATACCTACATACCTACATACACCTACATACATACCACCAAAGACTCGTTTCTTTT
TCCACGTGCAACATTCCGATGTGCCCGTTGGCTCTGGCCGCCGGTACCTACGGCTCCCTCGGGTGGGGCCCGCGC
TGATGACCTTTCAATTTCCAGGGTGACTCCTCAATTACCCCAGACCATGCAAGAGGATCTCCAGCGCCTCGAGCT
CGGTGACGGACAATCTTCCGAGGGCGCGTCTCGTCGCGGCCCATCGTCAACAAGAATCGCCGACTCGAGGCCTGG
ACGAGCCCCTGAGACGCCATCTGTCGACTCCTACAGCAGCAGCCCCCGGCTCGACAGCATGGATGCCGACGCTCC
CTCCTTTTCTCCTTTTCCAAAGGTCTCGGGCGATAACATACCCCCGGCCGACGACGCCAAGGAGGGCATCCTGTG
GAACGCGCGCAAGCACGTGCTGCACTCTCAGAATGTCTCGATGCAGATGAGCTGGGCTCGCGATGCCCTCGTCTG
GGTCGACATAGCTGCAGACGCCGCCGCTCGCGACTCAGCCGACAAGCCCCGTCCCGACACCCCGCGCATCGAGCA
CGAGCTGCGCGAAGACGCCTTGAACATTGTCAACTACCTGGCCCGTCAGGAGTACCCGGAGGCCCTCTATGTTCG
CTCCAAATGGCTCGAGTTCGGCAAGTTCGGCAACCGCGTCGACAAGCGAGAGGCCTACAACGGGTACAAACGTGC
CGCCGACCTGGGCCACGCCCGCTCCGAGTACCGCCTGGGTATGCTGTTTGAGCAGTCAAACGACATGTCCAAGGC
CAAGGAGCACTACTACAAGGGCATGAGCTTGAAGGACTCGGCATCCCTCTATCGCATGGGCATGATGAGCCTGCT
CGGCCAGCACGGCGAATCCAAGGACTACCCCCGAGGCCTCGAACGAATTCAGGCGGCCGCCGACAGCTCCGACGA
GGACGCGCCCCAAGGCTCGTACGTCTACGGCATGCTGGTAGGCAGAGACCTTCCCGACATCACCATCCCCGACGG
CCTCCTGCCCTACAGCCTGGAGACGGCCAAGATGTACGTCGAAAAGGCCGCCTATCTCGGCTTTGCCAAGGCTCA
GCTCAAGATGGGCCAGGCCTACGAGCTCTGCCAGCTCGCCTGCGAATTCCATCCGTCCTACTCCCTTCACTACTA
CGGACTCGCCGCCAGACAGGGCCTTCCAGAGGCCGCACTCGGCGTCAGCCGCTGGTTTCTCTTTGGATACGAGGG
CGTCTTCAAGAAGAATGAGGAGCTCGCCTTCAAGTACGCCCAAGAGGCTGCCCTGGCCAAGCTGCCGACGGGAGA
ATTCGCCATGGGCTACTACTACGAGATTGGCATCCACGTCAATAAGAGTATCGAAGACGCCCGGAAGTGGTATCA
GCTTGCGGCCGAACACGGCAACAAAGACGCGCAGAGTCGCCTAGACTCGCTGAGCCAAGACAAGAGCCTGTCGAA
GAGGGACCACGAGACGACGACGTTGACGCGCATCAAGTCCCAGCACGGTTCGCAACGGGGCAAGCGACCCGAACG
GTTCAAGCAGCCTCAGCAGATGCCGACGCTGAACGAGAGCGGCGCGTCCCCCACGCTCGACAACGAGGCGCGGAA
GGCGGCTTTGGCGGCATCGTCAACGACCGACTCCCCACGCATGTCGCCTCAACCGTCCCTGGGCGTCAGGCCCAC
CATTGTATCCGAGAGCGCCTCCTTCCCGGATCCCTCGAGGGCTTCTGTGGTGAGCGCCGACCGACAGTCGGCCTT
TGGCATCCGGCCGGACGTTGCGCGTCCGCGTTCCGCAGCGCCGTACCCTTCGGACGACGGGCCGATATCGAACCG
GTCGCGATCTACGGCGCCGTATCCGGAAGACGACATGGCCGTCGGGCCCAACATGTATCCCAACATGGCGTCTCA
CTCGCCTTACGCCGACCGGCCCATCAGCGCTTTCGCCGGCAAGGCGCCTGCCACGGGCCCGCGTCCCATGCCCAT
GTCACACAGCGTGGGCAGCCTCCAGCCGCAGCCGGCTCCCTCGTCCCAGGGGAGCAGGATCGCCTCTGCCGGCTT
TATGCGTACCGGTCCGGGAGGAAATCGACATGGGAGCCCGAGCCCGGGTCAGGCTGGCGGTCGCCCTTATCCTCC
CGACAACCCACAACAGGGTCGGTCCCCGAGCACGCAGCCGTATCCCAGCGGCAACAGGTTGCAGAAGCAAAACGA
CATCCGCGTGTCCGGCCAGGGTCAGGAGCGGCTTTCGAGAGTTCCCGGCGCGACGGGCAGGCCGGAGCGGCTCGG
CTCGGCTCCCCCGCAGGATCCACAGAGACCGGCTCGGATGTCGCCCAGCCCGGCGCAGACTCCTTCGAGGCCGGG
AATGGGAAGGATCGGCAGCGCCCCCTCGGCAGCGATTCTCTCTACGTCGACTTCTCACAGCTCGGCAGGCTCGTC
GTCGGCCAAGCCGAAACAGGGCCCTGCGACGTTTGAAGACATGGGAATTCCACAGGGAAAGCAGGAAGGCGATTG
TGTAAGTTTGATTTACGTGATGCTTGGGGCGAAATCTGACGTCGACGCAGGTTGTCATGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail