Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01759
Gene name
Locationscaffold_02:386386..387872
Strand-
Gene length (bp)1486
Transcript length (bp)1287
Coding sequence length (bp)1287
Protein length (aa) 429

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Peroxisomal targeting signal 0.5896 0.3368 0.0501 0.2293 0.2117 0.059 0.1622 0.184 0.0804 0.128

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4766
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4512
Ophiocordyceps australis map64 (Brazil) OphauB2|3354
Ophiocordyceps camponoti-floridani Ophcf2|01759 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|997
Ophiocordyceps kimflemingae Ophio5|4960
Ophiocordyceps subramaniannii Hirsu2|1006

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01759
MYTFCVGQMNNVDALYLDRILACDREDRYDSLRDKYAETNNIDICRNGHLVSRASDFIIYSVEAAAINAVIAQYG
PSSKMGAIVGGQTSCKSPEIAAFEAHLPADVSIVSFHSLHGPAVDPHNQPLVIIQHRAPDSAVRTVEKVLGCLRS
KFVHLSALEHDRITADTQAVTHAAFLSMGKAWHANRQFPWEMSRYVGGMESVKINTMLRIFSQKWHVYAGLAILN
PEARKQVAQYAESVTALYKLMLEGNLTGLRQRVYAAREKVFFRAPALSSWESGPLIQPAVLSSFSHGHPSDDEDA
PPPPPNNHLSLLAMVDCWAALGIVPYDHMLCSTPLFRLRLGVTEHLFRSTELLDEALQTAVCDKTYRSDDLEFTF
AARSWAECVGLADFETWRKRFESTQEFFRPRFAEARVIGERMMRTIVESTKKA*
Coding >Ophcf2|01759
ATGTACACCTTCTGTGTGGGGCAGATGAATAACGTAGACGCTCTCTATCTCGACAGGATCTTGGCCTGCGACAGG
GAAGATAGATACGATAGCCTGCGAGACAAATATGCCGAGACAAACAACATCGACATCTGCCGCAACGGCCATCTC
GTGTCCCGCGCCAGCGATTTCATCATCTATAGCGTCGAGGCCGCTGCCATCAATGCCGTTATCGCCCAGTACGGT
CCTTCCAGCAAGATGGGAGCCATTGTTGGCGGCCAGACGTCGTGCAAGTCTCCCGAGATAGCCGCCTTTGAGGCC
CATCTACCGGCGGACGTGTCCATTGTCTCGTTCCATTCCCTCCACGGGCCGGCCGTCGACCCTCACAACCAACCG
CTCGTCATCATCCAGCATCGGGCACCGGACTCGGCCGTACGAACCGTTGAGAAGGTTCTCGGCTGTCTACGATCC
AAGTTTGTTCACCTGTCGGCGCTGGAACACGATCGCATCACGGCCGATACGCAGGCCGTCACCCACGCGGCCTTC
TTATCAATGGGCAAAGCATGGCATGCCAACCGCCAGTTTCCATGGGAGATGAGCCGGTACGTGGGCGGGATGGAG
AGCGTCAAGATCAACACGATGCTTCGAATCTTCAGCCAAAAGTGGCACGTCTATGCCGGACTCGCCATCCTCAAC
CCAGAGGCCCGAAAGCAGGTGGCGCAGTACGCCGAGAGCGTGACGGCCCTCTACAAGCTGATGCTCGAGGGAAAC
CTCACAGGCCTCCGTCAGCGCGTCTACGCCGCCCGTGAAAAGGTCTTTTTCCGCGCACCCGCCCTCTCGTCATGG
GAATCCGGCCCTCTCATCCAACCAGCCGTCCTATCATCCTTCTCTCACGGCCACCCCTCCGACGACGAAGACGCT
CCCCCCCCACCGCCCAACAATCATCTCTCCCTCCTGGCCATGGTCGACTGCTGGGCCGCCCTCGGCATAGTCCCC
TACGACCACATGCTCTGCAGCACGCCCCTCTTCAGACTCCGCCTGGGCGTGACGGAGCATCTCTTCCGCAGCACG
GAGCTTCTCGACGAGGCCCTGCAAACGGCCGTCTGCGACAAGACGTACCGCAGCGACGACCTGGAGTTTACGTTC
GCGGCCCGGTCTTGGGCAGAGTGCGTCGGCCTTGCGGACTTTGAGACGTGGAGGAAGCGCTTCGAGAGTACGCAG
GAGTTTTTCCGGCCGCGGTTTGCGGAGGCGAGGGTTATTGGCGAGCGGATGATGAGGACGATTGTGGAGAGCACT
AAGAAGGCGTAG
Transcript >Ophcf2|01759
ATGTACACCTTCTGTGTGGGGCAGATGAATAACGTAGACGCTCTCTATCTCGACAGGATCTTGGCCTGCGACAGG
GAAGATAGATACGATAGCCTGCGAGACAAATATGCCGAGACAAACAACATCGACATCTGCCGCAACGGCCATCTC
GTGTCCCGCGCCAGCGATTTCATCATCTATAGCGTCGAGGCCGCTGCCATCAATGCCGTTATCGCCCAGTACGGT
CCTTCCAGCAAGATGGGAGCCATTGTTGGCGGCCAGACGTCGTGCAAGTCTCCCGAGATAGCCGCCTTTGAGGCC
CATCTACCGGCGGACGTGTCCATTGTCTCGTTCCATTCCCTCCACGGGCCGGCCGTCGACCCTCACAACCAACCG
CTCGTCATCATCCAGCATCGGGCACCGGACTCGGCCGTACGAACCGTTGAGAAGGTTCTCGGCTGTCTACGATCC
AAGTTTGTTCACCTGTCGGCGCTGGAACACGATCGCATCACGGCCGATACGCAGGCCGTCACCCACGCGGCCTTC
TTATCAATGGGCAAAGCATGGCATGCCAACCGCCAGTTTCCATGGGAGATGAGCCGGTACGTGGGCGGGATGGAG
AGCGTCAAGATCAACACGATGCTTCGAATCTTCAGCCAAAAGTGGCACGTCTATGCCGGACTCGCCATCCTCAAC
CCAGAGGCCCGAAAGCAGGTGGCGCAGTACGCCGAGAGCGTGACGGCCCTCTACAAGCTGATGCTCGAGGGAAAC
CTCACAGGCCTCCGTCAGCGCGTCTACGCCGCCCGTGAAAAGGTCTTTTTCCGCGCACCCGCCCTCTCGTCATGG
GAATCCGGCCCTCTCATCCAACCAGCCGTCCTATCATCCTTCTCTCACGGCCACCCCTCCGACGACGAAGACGCT
CCCCCCCCACCGCCCAACAATCATCTCTCCCTCCTGGCCATGGTCGACTGCTGGGCCGCCCTCGGCATAGTCCCC
TACGACCACATGCTCTGCAGCACGCCCCTCTTCAGACTCCGCCTGGGCGTGACGGAGCATCTCTTCCGCAGCACG
GAGCTTCTCGACGAGGCCCTGCAAACGGCCGTCTGCGACAAGACGTACCGCAGCGACGACCTGGAGTTTACGTTC
GCGGCCCGGTCTTGGGCAGAGTGCGTCGGCCTTGCGGACTTTGAGACGTGGAGGAAGCGCTTCGAGAGTACGCAG
GAGTTTTTCCGGCCGCGGTTTGCGGAGGCGAGGGTTATTGGCGAGCGGATGATGAGGACGATTGTGGAGAGCACT
AAGAAGGCGTAG
Gene >Ophcf2|01759
ATGTACACCTTCTGTGTGGTTCTTCTCTCGTTGCTTTGCTTGCAATATGCTGACCAAGTTGCCATTTCACAGGGG
CAGATGAATAACGTAGACGCTCTCTATCTCGACAGGATCTTGGCCTGCGACAGGGAAGATAGATACGATAGCCTG
CGAGACAAATATGCCGAGACAGTACGGCCATGATGCCATCGTACCTGTTGCCAACGGAGCTCTGACATGAAAGTC
AGAACAACATCGACATCTGCCGCAACGGCCATCTCGTGTCCCGCGCCAGCGATTTCATCATCTATAGCGTCGAGG
CCGCTGCCATCAATGCCGTTATCGCCCAGTACGGTCCTTGTACGAGTCTCCTTCCTATGACGATGCACCGGCGGG
CCACCGCCAGTCTTTCCATACGCCGGGTTCTGACCGTCGTTGCCGCAATGTAGCCAGCAAGATGGGAGCCATTGT
TGGCGGCCAGACGTCGTGCAAGTCTCCCGAGATAGCCGCCTTTGAGGCCCATCTACCGGCGGACGTGTCCATTGT
CTCGTTCCATTCCCTCCACGGGCCGGCCGTCGACCCTCACAACCAACCGCTCGTCATCATCCAGCATCGGGCACC
GGACTCGGCCGTACGAACCGTTGAGAAGGTTCTCGGCTGTCTACGATCCAAGTTTGTTCACCTGTCGGCGCTGGA
ACACGATCGCATCACGGCCGATACGCAGGCCGTCACCCACGCGGCCTTCTTATCAATGGGCAAAGCATGGCATGC
CAACCGCCAGTTTCCATGGGAGATGAGCCGGTACGTGGGCGGGATGGAGAGCGTCAAGATCAACACGATGCTTCG
AATCTTCAGCCAAAAGTGGCACGTCTATGCCGGACTCGCCATCCTCAACCCAGAGGCCCGAAAGCAGGTGGCGCA
GTACGCCGAGAGCGTGACGGCCCTCTACAAGCTGATGCTCGAGGGAAACCTCACAGGCCTCCGTCAGCGCGTCTA
CGCCGCCCGTGAAAAGGTCTTTTTCCGCGCACCCGCCCTCTCGTCATGGGAATCCGGCCCTCTCATCCAACCAGC
CGTCCTATCATCCTTCTCTCACGGCCACCCCTCCGACGACGAAGACGCTCCCCCCCCACCGCCCAACAATCATCT
CTCCCTCCTGGCCATGGTCGACTGCTGGGCCGCCCTCGGCATAGTCCCCTACGACCACATGCTCTGCAGCACGCC
CCTCTTCAGACTCCGCCTGGGCGTGACGGAGCATCTCTTCCGCAGCACGGAGCTTCTCGACGAGGCCCTGCAAAC
GGCCGTCTGCGACAAGACGTACCGCAGCGACGACCTGGAGTTTACGTTCGCGGCCCGGTCTTGGGCAGAGTGCGT
CGGCCTTGCGGACTTTGAGACGTGGAGGAAGCGCTTCGAGAGTACGCAGGAGTTTTTCCGGCCGCGGTTTGCGGA
GGCGAGGGTTATTGGCGAGCGGATGATGAGGACGATTGTGGAGAGCACTAAGAAGGCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail