Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01756
Gene name
Locationscaffold_02:381286..382081
Strand+
Gene length (bp)795
Transcript length (bp)795
Coding sequence length (bp)795
Protein length (aa) 265

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04157 EAP30 EAP30/Vps36 family 3.7E-67 6 239

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear export signal 0.5012 0.673 0.0075 0.0392 0.1713 0.0231 0.0561 0.5364 0.483 0.025

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5169
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1063
Ophiocordyceps australis map64 (Brazil) OphauB2|5084
Ophiocordyceps camponoti-floridani Ophcf2|01756 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|994
Ophiocordyceps kimflemingae Ophio5|4957
Ophiocordyceps subramaniannii Hirsu2|3819

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01756
MSRKGVGIGAFDRSRLTSQHYATHGSTLRASNASALSSQITVFRALLSQFAQTHAKDIRSDPAFRAQFARMCTAI
GVDPLAGGGGGAGAGGGSGGSGESIWAQLLGKTVNDFYFGLAVRVVDVCGRSRGENGGLIGVRELSARLSGEAGP
DISEDDVRRAVETLKPLGGGYGIVRVGRTEYVRSVPRELSSDQAAVVEAVHVLGYVSVGMLRDNLGWETARCQTV
IDDLVAQGMLWVDKQTSGEWEFWSPGFMVHADVDHGTPD*
Coding >Ophcf2|01756
ATGTCCCGCAAAGGCGTCGGCATAGGCGCCTTCGACCGCTCCCGCCTAACCTCCCAACACTACGCCACCCACGGC
TCAACCCTCCGCGCAAGCAACGCCTCGGCCCTCTCGAGCCAAATAACCGTCTTCCGCGCCCTCCTCTCGCAATTC
GCCCAAACGCACGCCAAAGACATACGCTCCGACCCGGCCTTCCGCGCGCAATTCGCCCGCATGTGCACCGCCATC
GGCGTCGATCCCCTAGCTGGCGGCGGCGGTGGCGCTGGCGCTGGCGGCGGCTCCGGAGGCTCGGGGGAGAGCATC
TGGGCGCAACTACTCGGCAAGACGGTCAACGACTTCTACTTCGGCCTTGCCGTTCGCGTCGTGGATGTTTGTGGG
AGGTCGAGGGGGGAGAATGGTGGGTTGATTGGTGTGAGGGAGTTGAGTGCTAGGCTTTCGGGGGAGGCGGGGCCG
GACATCTCGGAGGATGATGTTCGGCGCGCCGTCGAGACGTTGAAACCTCTGGGAGGGGGTTATGGCATCGTTCGC
GTGGGGAGGACCGAGTACGTTCGCAGTGTGCCGAGGGAGCTGAGCAGTGATCAGGCTGCTGTTGTCGAGGCGGTG
CACGTGCTCGGCTATGTCAGCGTCGGCATGCTGCGTGATAATCTGGGATGGGAGACGGCGCGGTGTCAGACGGTG
ATTGATGATCTTGTTGCGCAGGGGATGCTCTGGGTTGATAAGCAGACGTCTGGCGAGTGGGAGTTTTGGAGCCCT
GGCTTCATGGTTCATGCTGATGTTGATCATGGTACGCCTGACTGA
Transcript >Ophcf2|01756
ATGTCCCGCAAAGGCGTCGGCATAGGCGCCTTCGACCGCTCCCGCCTAACCTCCCAACACTACGCCACCCACGGC
TCAACCCTCCGCGCAAGCAACGCCTCGGCCCTCTCGAGCCAAATAACCGTCTTCCGCGCCCTCCTCTCGCAATTC
GCCCAAACGCACGCCAAAGACATACGCTCCGACCCGGCCTTCCGCGCGCAATTCGCCCGCATGTGCACCGCCATC
GGCGTCGATCCCCTAGCTGGCGGCGGCGGTGGCGCTGGCGCTGGCGGCGGCTCCGGAGGCTCGGGGGAGAGCATC
TGGGCGCAACTACTCGGCAAGACGGTCAACGACTTCTACTTCGGCCTTGCCGTTCGCGTCGTGGATGTTTGTGGG
AGGTCGAGGGGGGAGAATGGTGGGTTGATTGGTGTGAGGGAGTTGAGTGCTAGGCTTTCGGGGGAGGCGGGGCCG
GACATCTCGGAGGATGATGTTCGGCGCGCCGTCGAGACGTTGAAACCTCTGGGAGGGGGTTATGGCATCGTTCGC
GTGGGGAGGACCGAGTACGTTCGCAGTGTGCCGAGGGAGCTGAGCAGTGATCAGGCTGCTGTTGTCGAGGCGGTG
CACGTGCTCGGCTATGTCAGCGTCGGCATGCTGCGTGATAATCTGGGATGGGAGACGGCGCGGTGTCAGACGGTG
ATTGATGATCTTGTTGCGCAGGGGATGCTCTGGGTTGATAAGCAGACGTCTGGCGAGTGGGAGTTTTGGAGCCCT
GGCTTCATGGTTCATGCTGATGTTGATCATGGTACGCCTGACTGA
Gene >Ophcf2|01756
ATGTCCCGCAAAGGCGTCGGCATAGGCGCCTTCGACCGCTCCCGCCTAACCTCCCAACACTACGCCACCCACGGC
TCAACCCTCCGCGCAAGCAACGCCTCGGCCCTCTCGAGCCAAATAACCGTCTTCCGCGCCCTCCTCTCGCAATTC
GCCCAAACGCACGCCAAAGACATACGCTCCGACCCGGCCTTCCGCGCGCAATTCGCCCGCATGTGCACCGCCATC
GGCGTCGATCCCCTAGCTGGCGGCGGCGGTGGCGCTGGCGCTGGCGGCGGCTCCGGAGGCTCGGGGGAGAGCATC
TGGGCGCAACTACTCGGCAAGACGGTCAACGACTTCTACTTCGGCCTTGCCGTTCGCGTCGTGGATGTTTGTGGG
AGGTCGAGGGGGGAGAATGGTGGGTTGATTGGTGTGAGGGAGTTGAGTGCTAGGCTTTCGGGGGAGGCGGGGCCG
GACATCTCGGAGGATGATGTTCGGCGCGCCGTCGAGACGTTGAAACCTCTGGGAGGGGGTTATGGCATCGTTCGC
GTGGGGAGGACCGAGTACGTTCGCAGTGTGCCGAGGGAGCTGAGCAGTGATCAGGCTGCTGTTGTCGAGGCGGTG
CACGTGCTCGGCTATGTCAGCGTCGGCATGCTGCGTGATAATCTGGGATGGGAGACGGCGCGGTGTCAGACGGTG
ATTGATGATCTTGTTGCGCAGGGGATGCTCTGGGTTGATAAGCAGACGTCTGGCGAGTGGGAGTTTTGGAGCCCT
GGCTTCATGGTTCATGCTGATGTTGATCATGGTACGCCTGACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail