Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01749
Gene name
Locationscaffold_02:361876..366113
Strand-
Gene length (bp)4237
Transcript length (bp)4119
Coding sequence length (bp)4119
Protein length (aa) 1373

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14664 RICTOR_N Rapamycin-insensitive companion of mTOR, N-term 2.7E-133 229 605
PF14666 RICTOR_M Rapamycin-insensitive companion of mTOR, middle domain 8.4E-36 809 909
PF14663 RasGEF_N_2 Rapamycin-insensitive companion of mTOR RasGEF_N domain 1.8E-34 926 1028
PF14668 RICTOR_V Rapamycin-insensitive companion of mTOR, domain 5 1.9E-28 1102 1171
PF02185 HR1 Hr1 repeat 1.0E-16 103 168

GO

GO Term Description Terminal node
GO:0007165 signal transduction Yes
GO:0008150 biological_process No
GO:0050789 regulation of biological process No
GO:0009987 cellular process No
GO:0065007 biological regulation No
GO:0050794 regulation of cellular process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6882 0.4118 0.1929 0.1034 0.1325 0.0055 0.0914 0.1774 0.1696 0.041

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5630
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4502
Ophiocordyceps australis map64 (Brazil) OphauB2|3362
Ophiocordyceps camponoti-floridani Ophcf2|01749 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2214
Ophiocordyceps kimflemingae Ophio5|4949
Ophiocordyceps subramaniannii Hirsu2|7721

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01749
MPPPSSQQQPQQPGRSSFDRDGVPALQPPNGGQARKLSTSAMSFAPRGSSLNPNTGLGSFSSDLRSQTMSSRAAS
RAEVGSLYPASFADKVDEDDGSAASEQALAALRDKLNREMKIKEGSENMLEALNIKKAKQTKEQRQRVEAELSAS
NSRIKELRQKISDAQRPRAVPPTTPTRNLQSNGLLRSPPSISRSAMGSDIDEMLESPTLLLAELLQALEVEAMPP
EYYVSRANQLVELFKRHPAIKYDLVWSIFGLRMQMMLLSDSREVVAAGYRATRYAMTDAASLNKIRSLNVDYLVI
RSLNNYRKADVEREQALKFVRAFLDVKHGVRELSRAVVRTIVAVAEQSEDRRPGVQVADQNIDRLRPICIETLAE
IMVQDPRLLVASGGLGPLCDALAEGTYKAPESLISAFLYLLDTPCRRGYMQAGYGVEVVFTAFTDQLAGAESVLK
QNSRAIAVALKSWSGLMALCMYDFRPIRSLIASILFPNPAVRETVLDLFFSLLRIKPPAWATSFLAGRRLTTYGR
VANMKSTSGRERSGTLSNDEDTGEQNFVDHYTALLLAVFIRAGLLESLLRIAQSEEDATLKRKTTLLIGEVLKLA
SRLLPPSWSAELQLLPELFAAAAQFGNEAHFVASGIVYQISSVSRTLYRSAPCESIGGGGGGGGLSSSDSMQNLV
MAEEHPKASTAVVFDDATFRQLLIETGVLNSSNYLKWNWDVIFRVIDGPLQTGKRLEEAIKASKFMKRIMSFYRP
FKYKFADIRSSRNTHKYVKAGCALVHSLLQSPEGIRVLADSKLLRQIAECLAQCDPTSGLTAQFPMFAKDRLTDT
LCGGYFPMLGVLSSDANGLLLLERWRMFNMMYHIIDLKHRPDLIKLLLSNFDYSLQGHPRVLLSKALVAGTKEIR
IHATNTLRKCTMRPVSSLGGSGSDSRWAIQLLVTQLYDPEIEVCSTAVKILESACNRKTFLEYIVECRPALDHLG
EIGAPLLLRFLSTSIGYHYLDGLDYISNEMDDWFLGRNDSYVDVIEASLARAFLASPDDHGHRGSMFGESEADTD
YHDSHVPPHFYRELTRTREGCKLLSDKGHFDEFAATIRDHGMQTEDGELMTKVKGCLWAVGNVGSMELGAPFLES
SDVVERIMRVAESHEVMSLRGTAFFVLGLISRSTHGLEMLSEHGWEANTTAMGASLGFCIPNELSKLLSLKPWKH
VKAASITLLDTQRTVREQPKVRQARPPLAPSEMPPALTEADVNERIMELIVDLGNMVLYKKALTELQRLKQRKPK
AFRSVDFFKQVMGLMEWNHYRLGVRRLVIDLFDKSVMRQVVFGKAAGDVAAGKGVTKTGDEGEDSSEGDDRTERQ
RSISEPADMPLDMVPAPLQVRR*
Coding >Ophcf2|01749
ATGCCCCCCCCATCTTCTCAACAGCAGCCGCAGCAGCCTGGCCGCTCAAGCTTCGACCGCGATGGCGTCCCCGCT
CTGCAGCCTCCCAACGGCGGACAAGCTCGCAAGCTATCGACCTCGGCCATGTCCTTCGCGCCCCGAGGCAGCAGC
CTCAATCCCAACACGGGCCTCGGAAGCTTCAGCTCCGACCTGCGCAGCCAGACCATGTCGAGCCGTGCCGCCAGT
CGTGCCGAGGTCGGTTCCTTGTATCCTGCTAGCTTCGCGGACAAGGTCGACGAGGACGATGGCTCCGCCGCCTCT
GAACAGGCCCTCGCCGCTCTCCGCGACAAGCTCAACCGCGAGATGAAGATCAAGGAGGGCAGCGAAAACATGCTC
GAGGCCCTCAACATCAAAAAGGCCAAGCAGACCAAGGAGCAGCGCCAGAGGGTCGAGGCCGAGCTCAGCGCCAGC
AACTCGAGGATCAAGGAGCTCCGTCAGAAGATCTCGGATGCCCAACGTCCGAGAGCTGTTCCTCCCACGACGCCC
ACCAGGAACCTGCAGTCCAACGGTCTGCTCCGCTCGCCGCCGAGCATCTCACGATCCGCCATGGGTTCCGATATT
GACGAGATGCTAGAGAGTCCGACCCTACTGCTGGCCGAGCTGCTGCAGGCACTCGAGGTCGAGGCAATGCCGCCA
GAGTACTACGTCAGCCGCGCCAATCAACTGGTTGAGCTCTTCAAGCGCCACCCGGCCATCAAGTATGATCTGGTA
TGGTCCATATTCGGCCTTCGCATGCAGATGATGCTATTAAGCGACAGCCGCGAAGTCGTCGCCGCCGGTTACCGG
GCCACCAGATACGCGATGACGGACGCGGCCTCGCTCAACAAGATTCGCAGCCTCAACGTCGATTACCTGGTCATC
AGATCTCTCAACAACTACCGCAAGGCCGATGTCGAGCGCGAGCAAGCCCTCAAGTTCGTCCGCGCCTTTCTCGAC
GTCAAGCACGGCGTCAGGGAGCTCTCCCGCGCCGTGGTCCGCACCATTGTCGCCGTGGCCGAGCAGAGCGAAGAT
CGACGGCCCGGCGTCCAGGTGGCCGACCAAAACATCGACCGGCTGCGTCCCATCTGCATCGAGACGCTGGCCGAG
ATCATGGTCCAGGACCCGCGACTGCTCGTCGCGTCCGGGGGGCTCGGTCCGCTCTGCGACGCCCTGGCCGAGGGC
ACCTACAAAGCCCCGGAGAGCCTGATATCCGCCTTTCTCTACCTGCTCGACACGCCCTGCCGCCGCGGCTACATG
CAGGCCGGCTACGGCGTGGAGGTTGTCTTCACCGCCTTCACCGACCAGCTGGCCGGCGCCGAGAGCGTCCTCAAG
CAGAATTCGCGGGCCATTGCCGTCGCCTTGAAGTCGTGGTCGGGCCTCATGGCCCTCTGCATGTACGACTTTCGG
CCGATACGGTCCCTCATCGCGAGCATCCTGTTCCCCAACCCAGCAGTCCGCGAGACGGTCCTTGACCTGTTCTTC
TCTCTGCTGCGGATCAAGCCGCCCGCGTGGGCGACGTCGTTCCTGGCGGGACGGAGGCTGACGACGTACGGGCGC
GTGGCCAATATGAAGTCGACGAGCGGCAGGGAGCGCAGCGGCACGCTCTCCAACGACGAGGACACGGGCGAGCAG
AACTTTGTCGATCACTACACGGCGCTGCTGCTGGCCGTCTTTATCAGGGCCGGCCTGCTGGAGAGCCTGCTTCGG
ATCGCGCAGTCGGAGGAGGACGCGACGCTGAAGCGCAAGACGACGCTGCTGATCGGCGAGGTGCTGAAGCTGGCC
AGTCGGCTGCTGCCCCCCTCGTGGAGCGCCGAGCTTCAGTTGCTGCCGGAGCTGTTCGCGGCGGCTGCTCAGTTC
GGCAACGAGGCTCACTTCGTCGCGTCGGGCATCGTCTACCAGATCAGCAGCGTCAGCAGGACCCTGTACCGGAGC
GCCCCGTGCGAGTCCATCGGCGGCGGCGGCGGCGGCGGCGGCCTCTCGTCGAGCGACAGCATGCAGAACCTGGTC
ATGGCCGAGGAGCATCCCAAGGCCAGCACGGCCGTCGTGTTCGACGACGCCACGTTCCGCCAGCTCCTCATCGAG
ACGGGCGTGCTCAACAGCTCCAACTACCTCAAATGGAATTGGGACGTCATCTTCAGGGTCATCGACGGGCCCCTG
CAGACGGGGAAGCGGCTGGAAGAGGCCATCAAGGCGTCAAAGTTTATGAAGCGCATCATGAGCTTCTACCGGCCC
TTCAAGTACAAGTTTGCCGACATCAGGAGCTCGCGCAACACGCACAAGTACGTCAAGGCCGGGTGTGCCCTGGTA
CACTCCCTGCTGCAGTCTCCCGAGGGCATCAGGGTGCTGGCGGACAGCAAGCTGCTGAGGCAGATCGCCGAGTGT
CTGGCGCAGTGCGATCCGACGAGCGGGCTCACGGCTCAGTTCCCCATGTTCGCCAAGGACCGGCTCACCGACACG
CTCTGTGGGGGATACTTTCCCATGCTCGGCGTCCTCAGCAGCGACGCCAACGGGCTTCTGCTGCTGGAGAGGTGG
AGGATGTTCAACATGATGTATCACATCATCGACCTGAAGCATCGACCGGACCTTATCAAGCTCCTCCTGTCCAAC
TTCGACTACAGCCTCCAGGGACACCCGCGCGTCCTGCTGTCCAAGGCGCTGGTGGCGGGCACCAAGGAGATACGG
ATCCACGCGACCAACACGCTGCGAAAGTGCACCATGAGGCCCGTCTCCTCGCTGGGTGGCAGTGGCAGTGACTCG
AGGTGGGCGATCCAGCTGCTCGTCACGCAGCTGTACGATCCGGAGATCGAGGTGTGCTCGACGGCGGTCAAGATT
CTGGAGAGCGCGTGTAACCGCAAGACGTTCCTCGAGTACATCGTCGAGTGCCGGCCGGCGCTGGACCATCTGGGC
GAGATCGGGGCGCCGCTGCTGCTGCGATTCCTGTCGACGTCGATCGGATATCACTACCTGGACGGGCTGGACTAC
ATCAGCAATGAGATGGACGACTGGTTCCTCGGACGAAACGACTCGTACGTCGACGTCATAGAGGCCAGCCTGGCT
AGGGCCTTTCTGGCGAGCCCGGACGACCACGGCCACCGAGGCAGCATGTTTGGCGAGAGCGAGGCCGATACGGAC
TATCACGACAGCCACGTGCCGCCCCATTTCTACCGGGAGCTGACGCGCACGCGCGAGGGCTGCAAGTTGCTAAGC
GACAAGGGCCACTTTGACGAGTTCGCGGCGACGATCCGCGACCACGGCATGCAGACGGAGGACGGCGAGCTGATG
ACAAAGGTCAAGGGATGCCTCTGGGCCGTGGGTAACGTCGGGTCGATGGAGCTGGGCGCGCCCTTTCTCGAGTCC
AGCGACGTGGTGGAACGCATCATGCGCGTGGCCGAGTCTCACGAGGTCATGAGTCTGCGCGGCACCGCCTTCTTC
GTCCTGGGCCTAATCTCGCGGTCGACGCACGGGCTGGAGATGTTGTCGGAGCACGGGTGGGAGGCCAATACGACG
GCCATGGGGGCCTCGCTCGGCTTCTGCATCCCCAACGAGCTGTCGAAGCTGCTCTCGCTGAAACCGTGGAAGCAC
GTGAAGGCGGCGTCCATCACGCTGCTCGACACGCAGCGGACGGTGCGGGAGCAGCCCAAGGTGCGGCAAGCGCGC
CCACCGCTGGCACCGTCGGAGATGCCGCCGGCGCTGACGGAGGCCGATGTCAACGAGCGCATCATGGAGCTCATC
GTCGATCTGGGCAACATGGTCTTGTACAAGAAGGCGTTGACGGAACTGCAGCGGCTCAAGCAGCGCAAGCCCAAG
GCCTTTCGCAGCGTCGACTTCTTCAAACAGGTCATGGGCCTGATGGAGTGGAACCACTACCGGCTCGGAGTGCGG
CGGCTGGTGATTGACCTGTTCGACAAGAGCGTGATGCGACAGGTCGTCTTCGGCAAGGCCGCGGGCGACGTGGCG
GCCGGTAAAGGCGTGACGAAGACGGGCGACGAGGGCGAGGATAGCAGCGAGGGAGACGATCGGACGGAGAGGCAG
AGGAGTATCAGCGAGCCGGCGGACATGCCTTTGGACATGGTGCCTGCGCCGCTGCAGGTGCGAAGATGA
Transcript >Ophcf2|01749
ATGCCCCCCCCATCTTCTCAACAGCAGCCGCAGCAGCCTGGCCGCTCAAGCTTCGACCGCGATGGCGTCCCCGCT
CTGCAGCCTCCCAACGGCGGACAAGCTCGCAAGCTATCGACCTCGGCCATGTCCTTCGCGCCCCGAGGCAGCAGC
CTCAATCCCAACACGGGCCTCGGAAGCTTCAGCTCCGACCTGCGCAGCCAGACCATGTCGAGCCGTGCCGCCAGT
CGTGCCGAGGTCGGTTCCTTGTATCCTGCTAGCTTCGCGGACAAGGTCGACGAGGACGATGGCTCCGCCGCCTCT
GAACAGGCCCTCGCCGCTCTCCGCGACAAGCTCAACCGCGAGATGAAGATCAAGGAGGGCAGCGAAAACATGCTC
GAGGCCCTCAACATCAAAAAGGCCAAGCAGACCAAGGAGCAGCGCCAGAGGGTCGAGGCCGAGCTCAGCGCCAGC
AACTCGAGGATCAAGGAGCTCCGTCAGAAGATCTCGGATGCCCAACGTCCGAGAGCTGTTCCTCCCACGACGCCC
ACCAGGAACCTGCAGTCCAACGGTCTGCTCCGCTCGCCGCCGAGCATCTCACGATCCGCCATGGGTTCCGATATT
GACGAGATGCTAGAGAGTCCGACCCTACTGCTGGCCGAGCTGCTGCAGGCACTCGAGGTCGAGGCAATGCCGCCA
GAGTACTACGTCAGCCGCGCCAATCAACTGGTTGAGCTCTTCAAGCGCCACCCGGCCATCAAGTATGATCTGGTA
TGGTCCATATTCGGCCTTCGCATGCAGATGATGCTATTAAGCGACAGCCGCGAAGTCGTCGCCGCCGGTTACCGG
GCCACCAGATACGCGATGACGGACGCGGCCTCGCTCAACAAGATTCGCAGCCTCAACGTCGATTACCTGGTCATC
AGATCTCTCAACAACTACCGCAAGGCCGATGTCGAGCGCGAGCAAGCCCTCAAGTTCGTCCGCGCCTTTCTCGAC
GTCAAGCACGGCGTCAGGGAGCTCTCCCGCGCCGTGGTCCGCACCATTGTCGCCGTGGCCGAGCAGAGCGAAGAT
CGACGGCCCGGCGTCCAGGTGGCCGACCAAAACATCGACCGGCTGCGTCCCATCTGCATCGAGACGCTGGCCGAG
ATCATGGTCCAGGACCCGCGACTGCTCGTCGCGTCCGGGGGGCTCGGTCCGCTCTGCGACGCCCTGGCCGAGGGC
ACCTACAAAGCCCCGGAGAGCCTGATATCCGCCTTTCTCTACCTGCTCGACACGCCCTGCCGCCGCGGCTACATG
CAGGCCGGCTACGGCGTGGAGGTTGTCTTCACCGCCTTCACCGACCAGCTGGCCGGCGCCGAGAGCGTCCTCAAG
CAGAATTCGCGGGCCATTGCCGTCGCCTTGAAGTCGTGGTCGGGCCTCATGGCCCTCTGCATGTACGACTTTCGG
CCGATACGGTCCCTCATCGCGAGCATCCTGTTCCCCAACCCAGCAGTCCGCGAGACGGTCCTTGACCTGTTCTTC
TCTCTGCTGCGGATCAAGCCGCCCGCGTGGGCGACGTCGTTCCTGGCGGGACGGAGGCTGACGACGTACGGGCGC
GTGGCCAATATGAAGTCGACGAGCGGCAGGGAGCGCAGCGGCACGCTCTCCAACGACGAGGACACGGGCGAGCAG
AACTTTGTCGATCACTACACGGCGCTGCTGCTGGCCGTCTTTATCAGGGCCGGCCTGCTGGAGAGCCTGCTTCGG
ATCGCGCAGTCGGAGGAGGACGCGACGCTGAAGCGCAAGACGACGCTGCTGATCGGCGAGGTGCTGAAGCTGGCC
AGTCGGCTGCTGCCCCCCTCGTGGAGCGCCGAGCTTCAGTTGCTGCCGGAGCTGTTCGCGGCGGCTGCTCAGTTC
GGCAACGAGGCTCACTTCGTCGCGTCGGGCATCGTCTACCAGATCAGCAGCGTCAGCAGGACCCTGTACCGGAGC
GCCCCGTGCGAGTCCATCGGCGGCGGCGGCGGCGGCGGCGGCCTCTCGTCGAGCGACAGCATGCAGAACCTGGTC
ATGGCCGAGGAGCATCCCAAGGCCAGCACGGCCGTCGTGTTCGACGACGCCACGTTCCGCCAGCTCCTCATCGAG
ACGGGCGTGCTCAACAGCTCCAACTACCTCAAATGGAATTGGGACGTCATCTTCAGGGTCATCGACGGGCCCCTG
CAGACGGGGAAGCGGCTGGAAGAGGCCATCAAGGCGTCAAAGTTTATGAAGCGCATCATGAGCTTCTACCGGCCC
TTCAAGTACAAGTTTGCCGACATCAGGAGCTCGCGCAACACGCACAAGTACGTCAAGGCCGGGTGTGCCCTGGTA
CACTCCCTGCTGCAGTCTCCCGAGGGCATCAGGGTGCTGGCGGACAGCAAGCTGCTGAGGCAGATCGCCGAGTGT
CTGGCGCAGTGCGATCCGACGAGCGGGCTCACGGCTCAGTTCCCCATGTTCGCCAAGGACCGGCTCACCGACACG
CTCTGTGGGGGATACTTTCCCATGCTCGGCGTCCTCAGCAGCGACGCCAACGGGCTTCTGCTGCTGGAGAGGTGG
AGGATGTTCAACATGATGTATCACATCATCGACCTGAAGCATCGACCGGACCTTATCAAGCTCCTCCTGTCCAAC
TTCGACTACAGCCTCCAGGGACACCCGCGCGTCCTGCTGTCCAAGGCGCTGGTGGCGGGCACCAAGGAGATACGG
ATCCACGCGACCAACACGCTGCGAAAGTGCACCATGAGGCCCGTCTCCTCGCTGGGTGGCAGTGGCAGTGACTCG
AGGTGGGCGATCCAGCTGCTCGTCACGCAGCTGTACGATCCGGAGATCGAGGTGTGCTCGACGGCGGTCAAGATT
CTGGAGAGCGCGTGTAACCGCAAGACGTTCCTCGAGTACATCGTCGAGTGCCGGCCGGCGCTGGACCATCTGGGC
GAGATCGGGGCGCCGCTGCTGCTGCGATTCCTGTCGACGTCGATCGGATATCACTACCTGGACGGGCTGGACTAC
ATCAGCAATGAGATGGACGACTGGTTCCTCGGACGAAACGACTCGTACGTCGACGTCATAGAGGCCAGCCTGGCT
AGGGCCTTTCTGGCGAGCCCGGACGACCACGGCCACCGAGGCAGCATGTTTGGCGAGAGCGAGGCCGATACGGAC
TATCACGACAGCCACGTGCCGCCCCATTTCTACCGGGAGCTGACGCGCACGCGCGAGGGCTGCAAGTTGCTAAGC
GACAAGGGCCACTTTGACGAGTTCGCGGCGACGATCCGCGACCACGGCATGCAGACGGAGGACGGCGAGCTGATG
ACAAAGGTCAAGGGATGCCTCTGGGCCGTGGGTAACGTCGGGTCGATGGAGCTGGGCGCGCCCTTTCTCGAGTCC
AGCGACGTGGTGGAACGCATCATGCGCGTGGCCGAGTCTCACGAGGTCATGAGTCTGCGCGGCACCGCCTTCTTC
GTCCTGGGCCTAATCTCGCGGTCGACGCACGGGCTGGAGATGTTGTCGGAGCACGGGTGGGAGGCCAATACGACG
GCCATGGGGGCCTCGCTCGGCTTCTGCATCCCCAACGAGCTGTCGAAGCTGCTCTCGCTGAAACCGTGGAAGCAC
GTGAAGGCGGCGTCCATCACGCTGCTCGACACGCAGCGGACGGTGCGGGAGCAGCCCAAGGTGCGGCAAGCGCGC
CCACCGCTGGCACCGTCGGAGATGCCGCCGGCGCTGACGGAGGCCGATGTCAACGAGCGCATCATGGAGCTCATC
GTCGATCTGGGCAACATGGTCTTGTACAAGAAGGCGTTGACGGAACTGCAGCGGCTCAAGCAGCGCAAGCCCAAG
GCCTTTCGCAGCGTCGACTTCTTCAAACAGGTCATGGGCCTGATGGAGTGGAACCACTACCGGCTCGGAGTGCGG
CGGCTGGTGATTGACCTGTTCGACAAGAGCGTGATGCGACAGGTCGTCTTCGGCAAGGCCGCGGGCGACGTGGCG
GCCGGTAAAGGCGTGACGAAGACGGGCGACGAGGGCGAGGATAGCAGCGAGGGAGACGATCGGACGGAGAGGCAG
AGGAGTATCAGCGAGCCGGCGGACATGCCTTTGGACATGGTGCCTGCGCCGCTGCAGGTGCGAAGATGA
Gene >Ophcf2|01749
ATGCCCCCCCCATCTTCTCAACAGCAGCCGCAGCAGCCTGGCCGCTCAAGCTTCGACCGCGATGGCGTCCCCGCT
CTGCAGCCTCCCAACGGCGGACAAGCTCGCAAGCTATCGACCTCGGCCATGTCCTTCGCGCCCCGAGGCAGCAGC
CTCAATCCCAACACGGGCCTCGGAAGCTTCAGCTCCGACCTGCGCAGCCAGACCATGTCGAGCCGTGCCGCCAGT
CGTGCCGAGGTCGGTTCCTTGTATCCTGCTAGCTTCGCGGACAAGGTCGACGAGGACGATGGCTCCGCCGCCTCT
GAACAGGCCCTCGCCGCTCTCCGCGACAAGCTCAACCGCGAGATGAAGATCAAGGAGGGCAGCGAAAACATGCTC
GAGGCCCTCAACATCAAAAAGGCCAAGCAGACCAAGGAGCAGCGCCAGAGGGTCGAGGCCGAGCTCAGCGCCAGC
AACTCGAGGATCAAGGAGCTCCGTCAGAAGATCTCGGATGCCCAACGTCCGAGAGCTGTTCCTCCCACGACGCCC
ACCAGGAACCTGCAGTCCAACGGTCTGCTCCGCTCGCCGCCGAGCATCTCACGATCCGCCATGGGTTCCGATATT
GACGAGATGCTAGAGAGTCCGACCCTACTGCTGGCCGAGCTGCTGCAGGCACTCGAGGTCGAGGCAATGCCGCCA
GAGTACTACGTCAGCCGCGCCAATCAACTGGTTGAGCTCTTCAAGCGCCACCCGGCCATCAAGTATGATCTGGTA
TGGTCCATATTCGGCCTTCGCATGCAGATGATGCTATTAAGCGACAGCCGCGAAGTCGTCGCCGCCGGTTACCGG
GCCACCAGATACGCGATGACGGACGCGGCCTCGCTCAACAAGATTCGCAGCCTCAACGTCGATTACCTGGTCATC
AGGTGACGTCCCTCCGATCCCTCATTCACCCCAGCCAGACAGACCACTGATGACCCTCCGCAGATCTCTCAACAA
CTACCGCAAGGCCGATGTCGAGCGCGAGCAAGCCCTCAAGTTCGTCCGCGCCTTTCTCGACGTCAAGCACGGCGT
CAGGGAGCTCTCCCGCGCCGTGGTCCGCACCATTGTCGCCGTGGCCGAGCAGAGCGAAGATCGACGGCCCGGCGT
CCAGGTGGCCGACCAAAACATCGACCGGCTGCGTCCCATCTGCATCGAGACGCTGGCCGAGATCATGGTCCAGGA
CCCGCGACTGCTCGTCGCGTCCGGGGGGCTCGGTCCGCTCTGCGACGCCCTGGCCGAGGGCACCTACAAAGCCCC
GGAGAGCCTGATATCCGCCTTTCTCTACCTGCTCGACACGCCCTGCCGCCGCGGCTACATGCAGGCCGGCTACGG
CGTGGAGGTTGTCTTCACCGCCTTCACCGACCAGCTGGCCGGCGCCGAGAGCGTCCTCAAGCAGAATTCGCGGGC
CATTGCCGTCGCCTTGAAGTCGTGGTCGGGCCTCATGGCCCTCTGCATGTACGACTTTCGGCCGATACGGTCCCT
CATCGCGAGCATCCTGTTCCCCAACCCAGCAGTCCGCGAGACGGTCCTTGACCTGTTCTTCTCTCTGCTGCGGAT
CAAGCCGCCCGCGTGGGCGACGTCGTTCCTGGCGGGACGGAGGCTGACGACGTACGGGCGCGTGGCCAATATGAA
GTCGACGAGCGGCAGGGAGCGCAGCGGCACGCTCTCCAACGACGAGGACACGGGCGAGCAGAACTTTGTCGATCA
CTACACGGCGCTGCTGCTGGCCGTCTTTATCAGGGCCGGCCTGCTGGAGAGCCTGCTTCGGATCGCGCAGTCGGA
GGAGGACGCGACGCTGAAGCGCAAGACGACGCTGCTGATCGGCGAGGTGCTGAAGCTGGCCAGTCGGCTGCTGCC
CCCCTCGTGGAGCGCCGAGCTTCAGTTGCTGCCGGAGCTGTTCGCGGCGGCTGCTCAGTTCGGCAACGAGGCTCA
CTTCGTCGCGTCGGGCATCGTCTACCAGATCAGCAGCGTCAGCAGGACCCTGTACCGGAGCGCCCCGTGCGAGTC
CATCGGCGGCGGCGGCGGCGGCGGCGGCCTCTCGTCGAGCGACAGCATGCAGAACCTGGTCATGGCCGAGGAGCA
TCCCAAGGCCAGCACGGCCGTCGTGTTCGACGACGCCACGTTCCGCCAGCTCCTCATCGAGACGGGCGTGCTCAA
CAGCTCCAACTACCTCAAATGGAATTGGGACGTCATCTTCAGGGTCATCGACGGGCCCCTGCAGACGGGGAAGCG
GCTGGAAGAGGCCATCAAGGCGTCAAAGTTTATGAAGCGCATCATGAGCTTCTACCGGCCCTTCAAGTACAAGTT
TGCCGACATCAGGAGCTCGCGCAACACGCACAAGTACGTCAAGGCCGGGTGTGCCCTGGTACACTCCCTGCTGCA
GTCTCCCGAGGGCATCAGGGTGCTGGCGGACAGCAAGCTGCTGAGGCAGATCGCCGAGTGTCTGGCGCAGTGCGA
TCCGGTAGGTTTCTCGAGCCAACAGGCAGAGCAGCTCACTGACTTTGGCTTCGGGGGGCAGACGAGCGGGCTCAC
GGCTCAGTTCCCCATGTTCGCCAAGGACCGGCTCACCGACACGCTCTGTGGGGGATACTTTCCCATGCTCGGCGT
CCTCAGCAGCGACGCCAACGGGCTTCTGCTGCTGGAGAGGTGGAGGATGTTCAACATGATGTATCACATCATCGA
CCTGAAGCATCGACCGGACCTTATCAAGCTCCTCCTGTCCAACTTCGACTACAGCCTCCAGGGACACCCGCGCGT
CCTGCTGTCCAAGGCGCTGGTGGCGGGCACCAAGGAGATACGGATCCACGCGACCAACACGCTGCGAAAGTGCAC
CATGAGGCCCGTCTCCTCGCTGGGTGGCAGTGGCAGTGACTCGAGGTGGGCGATCCAGCTGCTCGTCACGCAGCT
GTACGATCCGGAGATCGAGGTGTGCTCGACGGCGGTCAAGATTCTGGAGAGCGCGTGTAACCGCAAGACGTTCCT
CGAGTACATCGTCGAGTGCCGGCCGGCGCTGGACCATCTGGGCGAGATCGGGGCGCCGCTGCTGCTGCGATTCCT
GTCGACGTCGATCGGATATCACTACCTGGACGGGCTGGACTACATCAGCAATGAGATGGACGACTGGTTCCTCGG
ACGAAACGACTCGTACGTCGACGTCATAGAGGCCAGCCTGGCTAGGGCCTTTCTGGCGAGCCCGGACGACCACGG
CCACCGAGGCAGCATGTTTGGCGAGAGCGAGGCCGATACGGACTATCACGACAGCCACGTGCCGCCCCATTTCTA
CCGGGAGCTGACGCGCACGCGCGAGGGCTGCAAGTTGCTAAGCGACAAGGGCCACTTTGACGAGTTCGCGGCGAC
GATCCGCGACCACGGCATGCAGACGGAGGACGGCGAGCTGATGACAAAGGTCAAGGGATGCCTCTGGGCCGTGGG
TAACGTCGGGTCGATGGAGCTGGGCGCGCCCTTTCTCGAGTCCAGCGACGTGGTGGAACGCATCATGCGCGTGGC
CGAGTCTCACGAGGTCATGAGTCTGCGCGGCACCGCCTTCTTCGTCCTGGGCCTAATCTCGCGGTCGACGCACGG
GCTGGAGATGTTGTCGGAGCACGGGTGGGAGGCCAATACGACGGCCATGGGGGCCTCGCTCGGCTTCTGCATCCC
CAACGAGCTGTCGAAGCTGCTCTCGCTGAAACCGTGGAAGCACGTGAAGGCGGCGTCCATCACGCTGCTCGACAC
GCAGCGGACGGTGCGGGAGCAGCCCAAGGTGCGGCAAGCGCGCCCACCGCTGGCACCGTCGGAGATGCCGCCGGC
GCTGACGGAGGCCGATGTCAACGAGCGCATCATGGAGCTCATCGTCGATCTGGGCAACATGGTCTTGTACAAGAA
GGCGTTGACGGAACTGCAGCGGCTCAAGCAGCGCAAGCCCAAGGCCTTTCGCAGCGTCGACTTCTTCAAACAGGT
CATGGGCCTGATGGAGTGGAACCACTACCGGCTCGGAGTGCGGCGGCTGGTGATTGACCTGTTCGACAAGAGCGT
GATGCGACAGGTCGTCTTCGGCAAGGCCGCGGGCGACGTGGCGGCCGGTAAAGGCGTGACGAAGACGGGCGACGA
GGGCGAGGATAGCAGCGAGGGAGACGATCGGACGGAGAGGCAGAGGAGTATCAGCGAGCCGGCGGACATGCCTTT
GGACATGGTGCCTGCGCCGCTGCAGGTGCGAAGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail