Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01748
Gene name
Locationscaffold_02:359254..361378
Strand-
Gene length (bp)2124
Transcript length (bp)1386
Coding sequence length (bp)1386
Protein length (aa) 462

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08543 Phos_pyr_kin Phosphomethylpyrimidine kinase 4.0E-47 13 172
PF08543 Phos_pyr_kin Phosphomethylpyrimidine kinase 5.8E-14 176 226
PF03070 TENA_THI-4 TENA/THI-4/PQQC family 4.8E-44 250 454

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Peroxisomal targeting signal 0.8206 0.399 0.0193 0.0622 0.2269 0.1505 0.0814 0.4446 0.3254 0.2877

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5629
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4501
Ophiocordyceps australis map64 (Brazil) OphauB2|4599
Ophiocordyceps camponoti-floridani Ophcf2|01748 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2213
Ophiocordyceps kimflemingae Ophio5|4948
Ophiocordyceps subramaniannii Hirsu2|7720

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01748
MAPDRVLLVAGSDCSGGAGLEAGQKVLAAHTCYAMTATTALTVQDTTGVDGIHVVPAEFVERQMEACLIDVGADV
VVTGMLAAADTVEAVARQLVKHAVPLIVIDPVIVSTSGARLLPDEAVSSLINHLLPLGTIVTPNLPEAQLLVGDS
NLDTIRSVADIEALGRRIQGLGPDVSTHGTGCSLAAAISSGLAKGSAVPDAVRAACRYVEVAIRKAPGLGRGHGP
LGHFHSTYCLPFSPGYFVEYLLARPDVKPLWHSFIHHPFVLALGDGSLPLESFKGYIVQDYLFLIHFSRAYALAA
YKANNMADIESAIQTTTNILHETKLHVQYCASFGISLSEMKATPEHQACTAYTRFVLDLGNAQDRLALNASLAPC
IMGYAAAARMLSARKETRREGNPYWEWIRNYDGEDSRRAAGRCAGLLEDEMLLQSPARIEELVGIFLHAIKMEMG
FWEMFPSCLSG*
Coding >Ophcf2|01748
ATGGCTCCGGACAGAGTGCTGCTAGTTGCCGGATCCGACTGCTCCGGCGGAGCCGGCCTGGAAGCCGGGCAGAAA
GTGCTGGCGGCACATACGTGCTACGCCATGACGGCGACGACGGCCCTCACGGTGCAGGACACGACGGGCGTCGAC
GGCATCCACGTCGTGCCGGCCGAGTTTGTCGAGCGTCAGATGGAAGCCTGTCTGATCGACGTGGGCGCTGACGTC
GTCGTTACCGGCATGCTCGCTGCTGCTGATACGGTTGAGGCTGTGGCACGACAGCTAGTCAAGCACGCCGTTCCC
CTCATCGTCATCGACCCCGTCATCGTCTCAACATCAGGCGCGCGCCTCCTCCCCGACGAAGCCGTGAGCAGTCTG
ATCAACCATCTCCTCCCGCTGGGGACGATCGTGACGCCCAATTTACCCGAGGCGCAGCTCCTGGTTGGCGACTCC
AACCTAGATACCATCCGCTCCGTGGCTGATATCGAGGCTCTGGGTCGGCGGATTCAGGGGCTCGGTCCGGATGTG
AGTACGCATGGGACGGGATGCTCGTTGGCTGCTGCGATATCGTCTGGTCTGGCCAAGGGGTCAGCTGTTCCTGAT
GCTGTTCGAGCTGCTTGTCGATATGTCGAGGTTGCCATCCGGAAAGCCCCTGGTTTGGGTCGTGGTCATGGACCT
TTGGGTCACTTTCACTCGACCTACTGCCTCCCTTTTTCCCCTGGCTATTTCGTCGAGTATCTACTCGCCCGTCCA
GACGTCAAGCCTCTCTGGCACTCGTTCATCCATCATCCCTTTGTCCTCGCTCTCGGCGATGGGTCGTTGCCGCTG
GAGTCCTTTAAGGGGTATATCGTGCAGGACTACCTATTCCTCATTCATTTCTCGCGGGCGTATGCTCTGGCAGCG
TACAAGGCGAATAACATGGCCGACATTGAATCCGCGATTCAAACGACAACAAACATCTTGCACGAAACGAAGCTT
CACGTCCAGTATTGCGCTTCCTTTGGCATCTCCCTCTCCGAGATGAAAGCCACCCCGGAGCATCAAGCCTGTACC
GCCTACACGCGATTCGTCCTCGACCTCGGCAACGCACAGGACCGTCTCGCTCTCAACGCATCTCTCGCCCCTTGC
ATAATGGGCTACGCGGCAGCGGCCCGCATGCTATCCGCTCGCAAGGAGACCCGTCGCGAGGGGAACCCTTACTGG
GAATGGATCCGGAATTATGATGGCGAGGATAGCCGGAGGGCTGCTGGGCGCTGTGCTGGCTTGCTGGAAGACGAG
ATGCTTCTGCAGTCGCCCGCCCGCATCGAGGAGCTTGTCGGCATCTTCCTTCATGCCATCAAGATGGAGATGGGC
TTTTGGGAAATGTTTCCATCGTGTCTGAGCGGTTGA
Transcript >Ophcf2|01748
ATGGCTCCGGACAGAGTGCTGCTAGTTGCCGGATCCGACTGCTCCGGCGGAGCCGGCCTGGAAGCCGGGCAGAAA
GTGCTGGCGGCACATACGTGCTACGCCATGACGGCGACGACGGCCCTCACGGTGCAGGACACGACGGGCGTCGAC
GGCATCCACGTCGTGCCGGCCGAGTTTGTCGAGCGTCAGATGGAAGCCTGTCTGATCGACGTGGGCGCTGACGTC
GTCGTTACCGGCATGCTCGCTGCTGCTGATACGGTTGAGGCTGTGGCACGACAGCTAGTCAAGCACGCCGTTCCC
CTCATCGTCATCGACCCCGTCATCGTCTCAACATCAGGCGCGCGCCTCCTCCCCGACGAAGCCGTGAGCAGTCTG
ATCAACCATCTCCTCCCGCTGGGGACGATCGTGACGCCCAATTTACCCGAGGCGCAGCTCCTGGTTGGCGACTCC
AACCTAGATACCATCCGCTCCGTGGCTGATATCGAGGCTCTGGGTCGGCGGATTCAGGGGCTCGGTCCGGATGTG
AGTACGCATGGGACGGGATGCTCGTTGGCTGCTGCGATATCGTCTGGTCTGGCCAAGGGGTCAGCTGTTCCTGAT
GCTGTTCGAGCTGCTTGTCGATATGTCGAGGTTGCCATCCGGAAAGCCCCTGGTTTGGGTCGTGGTCATGGACCT
TTGGGTCACTTTCACTCGACCTACTGCCTCCCTTTTTCCCCTGGCTATTTCGTCGAGTATCTACTCGCCCGTCCA
GACGTCAAGCCTCTCTGGCACTCGTTCATCCATCATCCCTTTGTCCTCGCTCTCGGCGATGGGTCGTTGCCGCTG
GAGTCCTTTAAGGGGTATATCGTGCAGGACTACCTATTCCTCATTCATTTCTCGCGGGCGTATGCTCTGGCAGCG
TACAAGGCGAATAACATGGCCGACATTGAATCCGCGATTCAAACGACAACAAACATCTTGCACGAAACGAAGCTT
CACGTCCAGTATTGCGCTTCCTTTGGCATCTCCCTCTCCGAGATGAAAGCCACCCCGGAGCATCAAGCCTGTACC
GCCTACACGCGATTCGTCCTCGACCTCGGCAACGCACAGGACCGTCTCGCTCTCAACGCATCTCTCGCCCCTTGC
ATAATGGGCTACGCGGCAGCGGCCCGCATGCTATCCGCTCGCAAGGAGACCCGTCGCGAGGGGAACCCTTACTGG
GAATGGATCCGGAATTATGATGGCGAGGATAGCCGGAGGGCTGCTGGGCGCTGTGCTGGCTTGCTGGAAGACGAG
ATGCTTCTGCAGTCGCCCGCCCGCATCGAGGAGCTTGTCGGCATCTTCCTTCATGCCATCAAGATGGAGATGGGC
TTTTGGGAAATGTTTCCATCGTGTCTGAGCGGTTGA
Gene >Ophcf2|01748
ATGGCTCCGGACAGAGTGCTGCTAGTTGCCGGATCCGACTGCTCCGGCGGAGCGTGAGTCGGACAGTCCTCAACA
CCACTCACGAGAACTACCCTAACGATAGCTGGCTCAAGCGGCCTGGAAGCCGGGCAGAAAGTGCTGGCGGCACAT
ACGTGCTACGCCATGACGGCGACGACGGCCCTCACGGTGCAGGACACGACGGGCGTCGACGGCATCCACGTCGTG
CCGGCCGAGTTTGTCGAGCGTCAGATGGAAGCCTGTCTGATCGACGTGGGCGCTGACGTCGTCGTTACCGGTCCG
TCGTTCTGAGGGTGCTTATTCGCTGATGGGAATATAACTTTCAAGGCATGCTCGCTGCTGCTGATACGGTTGAGG
CTGTGGCACGACAGCTAGTCAAGCACGCCGTTCCCCTCATCGTCATCGACCCCGTCATCGTCTCAACATCAGGCG
CGCGCCTCCTCCCCGACGAAGCCGTGAGCAGTCTGATCAACCATCTCCTCCCGCTGGGGACGATCGTGACGCCCA
ATTTACCCGAGGCGCAGCTCCTGGTTGGCGACTCCAACCTAGATACCATCCGCTCCGTGGCTGATATCGAGGCTC
TGGGTCGGCGGATTCAGGGGCTCGGTCCGGAGTGGGTGCTCGTTAAGGGGGGGCATCTACCGCTGCGGGAGGATT
TGAGCGTCGCGGAGATGGAGAGTGAGAGGGCTTATGTGGTGGATTCTTTGATTGGGCCTGGGGGGGTTGTTTTGA
GGATGACGAGTTTATGGGTGGATAGTGTGAGTACGCATGGGACGGGATGCTCGTTGGCTGGTAGGCTTTACCCAG
TCTTGTTGAGGTGTTTTGCTGACGATTGACTCATCATCTCCTTCGCTTCATTTGGACCTTGTGCAGCTGCGATAT
CGTCTGGTCTGGCCAAGGGGTCAGCTGTTCCTGATGCTGTTCGAGCTGCTTGTCGATATGTCGAGGTTGCCATCC
GGAAAGCCCCTGGTTTGGGTCGTGGTCATGGACCTTTGGGTCACTTTCACTCGACCTACTGCCTCCCTTTTTCCC
CGTGAGTAACTTCTGGACTGTTTGTGTGACCCGTGCGTGGCTAATGGTCCTTGATTGACGACAGTGGCTATTTCG
TCGAGTATCTACTCGCCCGTCCAGACGTCAAGCCTCTCTGGCACTCGTTCATCCATCATCCCTTTGTCCTCGCTC
TCGGCGATGGGTCGTTGCCGCTGGAGTCCTTTAAGGGGTATATCGTGCAGGACTACCTATTCCTCGTGAGTGGAT
TCCTCAAGCTTGTGCTTAGGGAGTTCCATCTGATGATGTCAGATTCATTTCTCGCGGGCGTATGCTCTGGCAGCG
TACAAGGCGAATAACATGGCCGACATTGAATCCGTCTGCTACTCATCCCCAACAAAAAGCCAAGTAACGGATTCT
AACCCTTACAGGCGATTCAAACGACAACAAACATCTTGCACGAAACGAAGCTTCACGTCCAGTATTGCGCTTCCT
TTGGCATCTCCCTCTCCGAGATGAAAGCCACCCCGGAGCATCAAGGTACACGTCCCCTACCACAACAACCCATTC
TCAAACCACCACTTATACAACCCAGCCTGTACCGCCTACACGCGATTCGTCCTCGACCTCGGCAACGCACAGGAC
CGTCTCGCTCTCAACGCATCTCTCGCCCCTTGCATAATGGGCTACGCGGCAGCGGCCCGCATGCTATCCGCTCGC
AAGGAGACCCGTCGCGAGGGGAACCCTTACTGGGAATGGATCCGGAATTATGATGGCGAGGATAGCCGGAGGGCT
GCTGGGCGCTGTGCTGGTAGGTAAACAAACGCTCTGTTCTTCAAACTGCTTGCCTTTTTTATTTTTATTTGATTT
TTTTCTTTCTTTCTTTCTTACGCTGTGGTTTGTAGGCTTGCTGGAAGACGAGATGCTTCTGCAGTCGCCCGCCCG
CATCGAGGAGCTTGTCGGCATCTTCCTTCATGCCATCAAGGTAGGCATCACCCGCGTCTCCAAGAGGCTCTGCGA
AGAGGCCGTGTCTTGATCGATCTTGGTTGAACTGATTCTTTCGTTGGGTAGATGGAGATGGGCTTTTGGGAAATG
TTTCCATCGTGTCTGAGCGGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail