Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01746
Gene name
Locationscaffold_02:353369..355204
Strand-
Gene length (bp)1835
Transcript length (bp)1722
Coding sequence length (bp)1722
Protein length (aa) 574

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 2.4E-54 110 444
PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 9.1E-11 274 359

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1059 0.0972 0.0383 0.0932 0.8553 0.0601 0.344 0.1196 0.2258 0.0423

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5627
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4499
Ophiocordyceps australis map64 (Brazil) OphauB2|1093
Ophiocordyceps camponoti-floridani Ophcf2|01746 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2211
Ophiocordyceps kimflemingae Ophio5|4945
Ophiocordyceps subramaniannii Hirsu2|7717

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01746
MASLARAAAPWAKLVHRPLAASLRLSARPSIAIRLRTVASRSAHTEAAPESQPPPPPPPPPKPGRLRTALKWTWR
FTYISVGGLVGYSFYVIYQDRHPEPQAEPDPSKKTLVILGTGWASVALLKKLDTENYNVIVVSPRNYFLFTPLLP
SCTTGLIEHRSIMEPVRTILRHKRAAVKFYEAEASSIDPDRKVVKIVDNSEIKGATSETEIPYDMLVIGVGAENA
TFGIPGVRENSCFLKEIGDAQQIRKKIMDCVETAAFKGQSPEEVDRLMHMVVVGGGPTGVEFAGELRDFFEEDIK
KLVPDISPRFKVTLIEALPNVLPSFSKQLIDYTENTLREEKIDIKTKTMVKNVTDKTVEAEVTGADGSKQRVVIP
YGLLVWATGNAVRPIVKDLMSHITAQADSRRGLAVNEYLVVQGTRDIWAVGDCAVAGYAPTAQVASQEGNFLGRL
FNNMAKTEAHESRIRELSSRMNLGVGDSAQAAEEIEALEKQLRKMKDIKPFRYSHQGSLAYIGSEKAVADVSWWN
GNLATGGNLTYLFWRSAYLSMCFSTRNRVLVLVDWLKSKAFGRDVSRE*
Coding >Ophcf2|01746
ATGGCTTCCCTCGCGCGAGCTGCCGCTCCTTGGGCCAAGCTGGTTCACAGGCCGCTCGCAGCCTCTCTCCGTCTT
TCTGCCAGGCCCTCGATCGCCATCAGGCTGCGGACCGTCGCCTCCCGTAGCGCTCATACCGAGGCGGCACCCGAG
TCGCAGCCGCCGCCGCCGCCGCCGCCGCCGCCGAAGCCCGGCAGGTTGCGCACTGCCTTGAAATGGACCTGGCGC
TTTACTTACATCTCCGTCGGCGGGCTCGTTGGTTATTCTTTCTACGTCATCTATCAAGATCGTCATCCGGAGCCT
CAAGCTGAACCGGATCCCAGCAAGAAGACATTGGTTATTCTCGGAACTGGCTGGGCCTCTGTGGCTCTGCTCAAG
AAGCTCGACACGGAAAACTACAACGTCATCGTCGTCTCTCCCCGCAACTATTTCCTCTTCACCCCCTTGCTCCCC
TCGTGCACCACGGGCCTCATCGAGCACCGCTCCATCATGGAGCCTGTCCGCACCATTCTTCGCCATAAGCGAGCT
GCCGTCAAGTTCTACGAGGCCGAGGCTTCGTCAATCGACCCTGACCGCAAGGTTGTGAAAATCGTCGACAATTCG
GAGATCAAGGGCGCCACGTCGGAGACGGAGATTCCCTACGACATGCTCGTCATCGGCGTCGGTGCCGAGAACGCC
ACATTTGGCATCCCGGGCGTGCGCGAGAACAGCTGCTTCCTCAAGGAAATTGGCGATGCCCAGCAGATTCGCAAG
AAGATCATGGACTGCGTCGAGACGGCCGCCTTCAAGGGCCAGTCCCCGGAAGAGGTCGACCGGCTGATGCACATG
GTCGTCGTCGGCGGTGGTCCCACGGGTGTCGAGTTCGCCGGCGAGCTGCGCGACTTCTTTGAAGAGGACATCAAG
AAATTGGTCCCGGACATCAGCCCCCGCTTCAAGGTCACGCTCATCGAGGCTCTTCCCAATGTCCTGCCGTCCTTC
TCTAAGCAGCTGATTGACTACACCGAGAATACGCTCCGTGAGGAGAAGATTGACATCAAGACCAAGACCATGGTC
AAGAACGTCACCGACAAGACGGTCGAGGCCGAAGTGACGGGTGCCGACGGCAGCAAGCAGCGCGTCGTCATTCCC
TATGGTCTGCTCGTATGGGCCACCGGCAACGCCGTCAGGCCCATCGTCAAGGACCTGATGAGCCACATCACCGCC
CAGGCCGACTCCCGCCGAGGCCTCGCCGTCAACGAGTACCTGGTCGTTCAGGGTACCCGCGACATCTGGGCCGTT
GGCGACTGCGCCGTGGCAGGATATGCTCCCACCGCCCAGGTCGCGTCTCAGGAGGGTAACTTTCTTGGTCGACTG
TTCAACAACATGGCCAAGACGGAGGCTCACGAGTCGCGCATCCGTGAGCTCAGCAGCAGGATGAATCTCGGGGTC
GGCGACTCGGCCCAGGCGGCCGAGGAGATTGAAGCCCTCGAGAAGCAGCTGCGCAAGATGAAGGACATCAAGCCC
TTCCGCTACAGCCACCAGGGAAGTCTGGCGTACATTGGCAGCGAAAAGGCCGTCGCAGACGTCAGTTGGTGGAAC
GGCAATCTGGCCACTGGCGGCAACCTGACGTACCTGTTCTGGAGGAGTGCCTACCTGTCCATGTGCTTCAGCACT
CGGAACAGAGTTTTGGTCTTGGTGGACTGGCTCAAGTCCAAGGCTTTCGGTCGCGACGTGTCACGCGAGTAG
Transcript >Ophcf2|01746
ATGGCTTCCCTCGCGCGAGCTGCCGCTCCTTGGGCCAAGCTGGTTCACAGGCCGCTCGCAGCCTCTCTCCGTCTT
TCTGCCAGGCCCTCGATCGCCATCAGGCTGCGGACCGTCGCCTCCCGTAGCGCTCATACCGAGGCGGCACCCGAG
TCGCAGCCGCCGCCGCCGCCGCCGCCGCCGCCGAAGCCCGGCAGGTTGCGCACTGCCTTGAAATGGACCTGGCGC
TTTACTTACATCTCCGTCGGCGGGCTCGTTGGTTATTCTTTCTACGTCATCTATCAAGATCGTCATCCGGAGCCT
CAAGCTGAACCGGATCCCAGCAAGAAGACATTGGTTATTCTCGGAACTGGCTGGGCCTCTGTGGCTCTGCTCAAG
AAGCTCGACACGGAAAACTACAACGTCATCGTCGTCTCTCCCCGCAACTATTTCCTCTTCACCCCCTTGCTCCCC
TCGTGCACCACGGGCCTCATCGAGCACCGCTCCATCATGGAGCCTGTCCGCACCATTCTTCGCCATAAGCGAGCT
GCCGTCAAGTTCTACGAGGCCGAGGCTTCGTCAATCGACCCTGACCGCAAGGTTGTGAAAATCGTCGACAATTCG
GAGATCAAGGGCGCCACGTCGGAGACGGAGATTCCCTACGACATGCTCGTCATCGGCGTCGGTGCCGAGAACGCC
ACATTTGGCATCCCGGGCGTGCGCGAGAACAGCTGCTTCCTCAAGGAAATTGGCGATGCCCAGCAGATTCGCAAG
AAGATCATGGACTGCGTCGAGACGGCCGCCTTCAAGGGCCAGTCCCCGGAAGAGGTCGACCGGCTGATGCACATG
GTCGTCGTCGGCGGTGGTCCCACGGGTGTCGAGTTCGCCGGCGAGCTGCGCGACTTCTTTGAAGAGGACATCAAG
AAATTGGTCCCGGACATCAGCCCCCGCTTCAAGGTCACGCTCATCGAGGCTCTTCCCAATGTCCTGCCGTCCTTC
TCTAAGCAGCTGATTGACTACACCGAGAATACGCTCCGTGAGGAGAAGATTGACATCAAGACCAAGACCATGGTC
AAGAACGTCACCGACAAGACGGTCGAGGCCGAAGTGACGGGTGCCGACGGCAGCAAGCAGCGCGTCGTCATTCCC
TATGGTCTGCTCGTATGGGCCACCGGCAACGCCGTCAGGCCCATCGTCAAGGACCTGATGAGCCACATCACCGCC
CAGGCCGACTCCCGCCGAGGCCTCGCCGTCAACGAGTACCTGGTCGTTCAGGGTACCCGCGACATCTGGGCCGTT
GGCGACTGCGCCGTGGCAGGATATGCTCCCACCGCCCAGGTCGCGTCTCAGGAGGGTAACTTTCTTGGTCGACTG
TTCAACAACATGGCCAAGACGGAGGCTCACGAGTCGCGCATCCGTGAGCTCAGCAGCAGGATGAATCTCGGGGTC
GGCGACTCGGCCCAGGCGGCCGAGGAGATTGAAGCCCTCGAGAAGCAGCTGCGCAAGATGAAGGACATCAAGCCC
TTCCGCTACAGCCACCAGGGAAGTCTGGCGTACATTGGCAGCGAAAAGGCCGTCGCAGACGTCAGTTGGTGGAAC
GGCAATCTGGCCACTGGCGGCAACCTGACGTACCTGTTCTGGAGGAGTGCCTACCTGTCCATGTGCTTCAGCACT
CGGAACAGAGTTTTGGTCTTGGTGGACTGGCTCAAGTCCAAGGCTTTCGGTCGCGACGTGTCACGCGAGTAG
Gene >Ophcf2|01746
ATGGCTTCCCTCGCGCGAGCTGCCGCTCCTTGGGCCAAGCTGGTTCACAGGCCGCTCGCAGCCTCTCTCCGTCTT
TCTGCCAGGCCCTCGATCGCCATCAGGCTGCGGACCGTCGCCTCCCGTAGCGCTCATACCGAGGCGGCACCCGAG
TCGCAGCCGCCGCCGCCGCCGCCGCCGCCGCCGAAGCCCGGCAGGTTGCGCACTGCCTTGAAATGGACCTGGCGC
TTTACTTACATCTCCGTCGGCGGGCTCGTTGGTTATTCTTTCTACGTCATCTATCAAGATCGTCATCCGGAGCCT
CAAGCTGAACCGGATCCCAGCAAGAAGACATTGGTTATTCTCGGTGGGTAGATGTCGTCTCCATGTCCGGGACGA
GAACGGCGGCTGACGACTCGCGCAGGAACTGGCTGGGCCTCTGTGGCTCTGCTCAAGAAGCTCGACACGGAAAAC
TACAACGTCATCGTCGTCTCTCCCCGCAACTATTTCCTCTTCACCCCCTTGCTCCCCTCGTGCACCACGGGCCTC
ATCGAGCACCGCTCCATCATGGAGCCTGTCCGCACCATTCTTCGCCATAAGCGAGCTGCCGTCAAGTTCTACGAG
GCCGAGGCTTCGTCAATCGACCCTGACCGCAAGGTTGTGAAAATCGTCGACAATTCGGAGATCAAGGGCGCCACG
TCGGAGACGGAGATTCCCTACGACATGCTCGTCATCGGCGTCGGTGCCGAGAACGCCACATTTGGCATCCCGGGC
GTGCGCGAGAACAGCTGCTTCCTCAAGGAAATTGGCGATGCCCAGCAGATTCGCAAGAAGATCATGGACTGCGTC
GAGACGGCCGCCTTCAAGGGCCAGTCCCCGGAAGAGGTCGACCGGCTGATGCACATGGTCGTCGTCGGCGGTGGT
CCCACGGGTGTCGAGTTCGCCGGCGAGCTGCGCGACTTCTTTGAAGAGGACATCAAGAAATTGGTCCCGGACATC
AGCCCCCGCTTCAAGGTCACGCTCATCGAGGCTCTTCCCAATGTCCTGCCGTCCTTCTCTAAGCAGCTGATTGAC
TACACCGAGAATACGCTCCGTGAGGAGAAGATTGACATCAAGACCAAGACCATGGTCAAGAACGTCACCGACAAG
ACGGTCGAGGCCGAAGTGACGGGTGCCGACGGCAGCAAGCAGCGCGTCGTCATTCCCTATGGTCTGCTCGTATGG
GCCACCGGCAACGCCGTCAGGCCCATCGTCAAGGACCTGATGAGCCACATCACCGCCCAGGCCGACTCCCGCCGA
GGCCTCGCCGTCAACGAGTACCTGGTCGTTCAGGGTACCCGCGACATCTGGGCCGTTGGCGACTGCGCCGTGGCA
GGATATGCTCCCACCGCCCAGGTCGCGTCTCAGGAGGGTAACTTTCTTGGTCGACTGTTCAACAACATGGCCAAG
ACGGAGGCTCACGAGTCGCGCATCCGTGAGCTCAGCAGCAGGATGAATCTCGGGGTCGGCGACTCGGCCCAGGCG
GCCGAGGAGATTGAAGCCCTCGAGAAGCAGCTGCGCAAGATGAAGGACATCAAGCCCTTCCGCTACAGCCACCAG
GGAAGTCTGGCGTACATTGGCAGCGAAAAGGCCGTCGCAGACGTCAGTTGGTGGAACGGCAATCTGGCCACTGGC
GGCAACCTGACGTACCTGTTCTGGAGGAGTGCCTACCTGTCCATGTGCTTCAGCAGTGAGTTCTCCCCTTCACTA
CACTCTTTTGTCGTAGTCAGCTGACGACTTGAGCAGCTCGGAACAGAGTTTTGGTCTTGGTGGACTGGCTCAAGT
CCAAGGCTTTCGGTCGCGACGTGTCACGCGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail