Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01724
Gene name
Locationscaffold_02:271317..272804
Strand-
Gene length (bp)1487
Transcript length (bp)1359
Coding sequence length (bp)1359
Protein length (aa) 453

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07647 SAM_2 SAM domain (Sterile alpha motif) 6.1E-16 65 125
PF00536 SAM_1 SAM domain (Sterile alpha motif) 1.5E-14 64 124
PF00788 RA Ras association (RalGDS/AF-6) domain 6.0E-12 355 431

GO

GO Term Description Terminal node
GO:0007165 signal transduction Yes
GO:0005515 protein binding Yes
GO:0050794 regulation of cellular process No
GO:0008150 biological_process No
GO:0050789 regulation of biological process No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0065007 biological regulation No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6365 0.2985 0.0297 0.2072 0.1192 0.0031 0.1947 0.3305 0.2149 0.0019

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2147
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2118
Ophiocordyceps australis map64 (Brazil) OphauB2|1911
Ophiocordyceps camponoti-floridani Ophcf2|01724 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5739
Ophiocordyceps kimflemingae Ophio5|7944
Ophiocordyceps subramaniannii Hirsu2|2599

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01724
MMSFDGGTAYAESDADDEYERSIGDRSPVGESETSPMGSEPSTSTEHTPTTHRSERLPETMMTDWTAEECADFIG
SIGLGQYADGFVENEIVGEALVALQHQDLKSMGIASVGHRLTILKSVYDVKKAQDVPFESDHYLPMSADAEAQYA
TATLKDIRQLVEQLRLRDERMNLLEQDLRRTTEDFRRLREDMLPALRLAKDAQQPLPNVEGGGGYGYEAMLSPTP
PGPTPGLMRSYSQRKILIGATSKGSSPTQPTHERTIAEQALDPTNAAERAVMSSSHLAAMNGTASASSPNMPSPT
SPQNHGATLGSRSYSSASSGNHDHYKPASGSSSAPPPPRRRETPVPDTPSGSNASVEIFKSFRVSMDDPCHKVLP
AALKKYQINAPWDQYALYIVYGDQERCLGMDEKPLILFKQLDKEGKKPMFMLRKTNSAQVDGGDPGSAGMARGGD
GV*
Coding >Ophcf2|01724
ATGATGAGCTTCGACGGCGGCACGGCCTACGCCGAGTCGGACGCCGATGACGAGTACGAGCGGAGCATCGGAGAC
CGATCGCCGGTAGGAGAGTCGGAGACGTCGCCCATGGGGTCGGAGCCGTCGACGTCGACGGAGCACACGCCGACG
ACACACCGGTCGGAGCGACTGCCGGAGACGATGATGACGGACTGGACGGCCGAAGAGTGCGCCGACTTCATCGGC
TCCATCGGTCTGGGCCAGTATGCCGATGGCTTCGTCGAGAACGAGATTGTTGGCGAGGCGTTGGTGGCGTTGCAG
CACCAAGATCTCAAGAGCATGGGAATCGCCAGCGTCGGACACCGGCTGACGATTCTCAAGAGTGTCTACGACGTC
AAGAAGGCGCAGGACGTGCCGTTCGAGAGCGACCATTACCTCCCCATGTCGGCGGACGCGGAAGCGCAGTACGCG
ACGGCGACTCTCAAGGACATTCGACAGCTGGTGGAGCAGCTGCGGCTGCGGGACGAACGGATGAACCTGCTGGAA
CAGGATCTGCGGCGGACGACGGAAGATTTCCGACGGCTCAGAGAGGACATGCTACCGGCGCTGCGGCTGGCAAAA
GACGCGCAACAGCCGCTGCCCAACGTCGAAGGGGGGGGCGGCTACGGTTACGAGGCGATGCTGTCGCCGACGCCG
CCGGGGCCGACACCGGGCCTGATGCGATCCTACTCGCAGAGGAAGATTCTCATCGGAGCCACGTCCAAGGGCTCT
TCGCCGACGCAGCCGACGCACGAGCGGACGATTGCCGAGCAGGCTCTGGACCCGACCAACGCGGCGGAACGGGCC
GTCATGTCGTCTTCTCACTTGGCGGCCATGAACGGAACGGCGTCGGCATCGTCGCCCAACATGCCGTCACCGACG
TCTCCGCAGAACCACGGGGCGACGCTGGGATCGAGGTCATACTCGTCGGCCTCGTCGGGAAATCACGATCACTAC
AAGCCGGCATCGGGCTCGTCTTCGGCGCCGCCGCCGCCGCGCAGGAGGGAGACGCCGGTGCCGGACACGCCGAGC
GGCAGCAACGCGTCGGTCGAGATCTTCAAGTCGTTCCGCGTCAGCATGGACGACCCCTGTCACAAGGTGCTGCCG
GCTGCGCTCAAGAAGTACCAGATCAACGCGCCGTGGGATCAGTACGCGCTGTACATCGTCTACGGCGATCAGGAG
CGCTGTCTCGGCATGGACGAGAAGCCTCTCATCCTGTTCAAGCAGCTGGACAAGGAAGGGAAGAAGCCCATGTTT
ATGCTGCGCAAGACGAACAGCGCGCAGGTCGACGGCGGTGATCCGGGGAGTGCGGGCATGGCGAGGGGGGGCGAC
GGGGTATGA
Transcript >Ophcf2|01724
ATGATGAGCTTCGACGGCGGCACGGCCTACGCCGAGTCGGACGCCGATGACGAGTACGAGCGGAGCATCGGAGAC
CGATCGCCGGTAGGAGAGTCGGAGACGTCGCCCATGGGGTCGGAGCCGTCGACGTCGACGGAGCACACGCCGACG
ACACACCGGTCGGAGCGACTGCCGGAGACGATGATGACGGACTGGACGGCCGAAGAGTGCGCCGACTTCATCGGC
TCCATCGGTCTGGGCCAGTATGCCGATGGCTTCGTCGAGAACGAGATTGTTGGCGAGGCGTTGGTGGCGTTGCAG
CACCAAGATCTCAAGAGCATGGGAATCGCCAGCGTCGGACACCGGCTGACGATTCTCAAGAGTGTCTACGACGTC
AAGAAGGCGCAGGACGTGCCGTTCGAGAGCGACCATTACCTCCCCATGTCGGCGGACGCGGAAGCGCAGTACGCG
ACGGCGACTCTCAAGGACATTCGACAGCTGGTGGAGCAGCTGCGGCTGCGGGACGAACGGATGAACCTGCTGGAA
CAGGATCTGCGGCGGACGACGGAAGATTTCCGACGGCTCAGAGAGGACATGCTACCGGCGCTGCGGCTGGCAAAA
GACGCGCAACAGCCGCTGCCCAACGTCGAAGGGGGGGGCGGCTACGGTTACGAGGCGATGCTGTCGCCGACGCCG
CCGGGGCCGACACCGGGCCTGATGCGATCCTACTCGCAGAGGAAGATTCTCATCGGAGCCACGTCCAAGGGCTCT
TCGCCGACGCAGCCGACGCACGAGCGGACGATTGCCGAGCAGGCTCTGGACCCGACCAACGCGGCGGAACGGGCC
GTCATGTCGTCTTCTCACTTGGCGGCCATGAACGGAACGGCGTCGGCATCGTCGCCCAACATGCCGTCACCGACG
TCTCCGCAGAACCACGGGGCGACGCTGGGATCGAGGTCATACTCGTCGGCCTCGTCGGGAAATCACGATCACTAC
AAGCCGGCATCGGGCTCGTCTTCGGCGCCGCCGCCGCCGCGCAGGAGGGAGACGCCGGTGCCGGACACGCCGAGC
GGCAGCAACGCGTCGGTCGAGATCTTCAAGTCGTTCCGCGTCAGCATGGACGACCCCTGTCACAAGGTGCTGCCG
GCTGCGCTCAAGAAGTACCAGATCAACGCGCCGTGGGATCAGTACGCGCTGTACATCGTCTACGGCGATCAGGAG
CGCTGTCTCGGCATGGACGAGAAGCCTCTCATCCTGTTCAAGCAGCTGGACAAGGAAGGGAAGAAGCCCATGTTT
ATGCTGCGCAAGACGAACAGCGCGCAGGTCGACGGCGGTGATCCGGGGAGTGCGGGCATGGCGAGGGGGGGCGAC
GGGGTATGA
Gene >Ophcf2|01724
ATGATGAGCTTCGACGGCGGCACGGCCTACGCCGAGTCGGACGCCGATGACGAGTACGAGCGGAGCATCGGAGAC
CGATCGCCGGTAGGAGAGTCGGAGACGTCGCCCATGGGGTCGGAGCCGTCGACGTCGACGGAGCACACGCCGACG
ACACACCGGTCGGAGCGACTGCCGGAGACGATGATGACGGACTGGACGGCCGAAGAGTGCGCCGACTTCATCGGC
TCCATCGGTCTGGGCCAGTATGCCGATGGCTTCGTCGGTTCGTCGATGGTTGCCCCTCGGAACCCGCCTACGAGG
AACGATGGGGCTGACTGGTTGGCAGAGAACGAGATTGTTGGCGAGGCGTTGGTGGCGTTGCAGCACCAAGATCTC
AAGAGCATGGGAATCGCCAGCGTCGGACACCGGCTGACGATTCTCAAGAGTGTCTACGACGTCAAGAAGGCGCAG
GACGTGCCGTTCGAGAGCGACCATTACCTCCCCATGTGTCAGTCCCCGCCCTCTTCTTCTACTCTTCTCACTCCA
TCTCCCAGCTGACGAGAAGAGTGACAGCGGCGGACGCGGAAGCGCAGTACGCGACGGCGACTCTCAAGGACATTC
GACAGCTGGTGGAGCAGCTGCGGCTGCGGGACGAACGGATGAACCTGCTGGAACAGGATCTGCGGCGGACGACGG
AAGATTTCCGACGGCTCAGAGAGGACATGCTACCGGCGCTGCGGCTGGCAAAAGACGCGCAACAGCCGCTGCCCA
ACGTCGAAGGGGGGGGCGGCTACGGTTACGAGGCGATGCTGTCGCCGACGCCGCCGGGGCCGACACCGGGCCTGA
TGCGATCCTACTCGCAGAGGAAGATTCTCATCGGAGCCACGTCCAAGGGCTCTTCGCCGACGCAGCCGACGCACG
AGCGGACGATTGCCGAGCAGGCTCTGGACCCGACCAACGCGGCGGAACGGGCCGTCATGTCGTCTTCTCACTTGG
CGGCCATGAACGGAACGGCGTCGGCATCGTCGCCCAACATGCCGTCACCGACGTCTCCGCAGAACCACGGGGCGA
CGCTGGGATCGAGGTCATACTCGTCGGCCTCGTCGGGAAATCACGATCACTACAAGCCGGCATCGGGCTCGTCTT
CGGCGCCGCCGCCGCCGCGCAGGAGGGAGACGCCGGTGCCGGACACGCCGAGCGGCAGCAACGCGTCGGTCGAGA
TCTTCAAGTCGTTCCGCGTCAGCATGGACGACCCCTGTCACAAGGTGCTGCCGGCTGCGCTCAAGAAGTACCAGA
TCAACGCGCCGTGGGATCAGTACGCGCTGTACATCGTCTACGGCGATCAGGAGCGCTGTCTCGGCATGGACGAGA
AGCCTCTCATCCTGTTCAAGCAGCTGGACAAGGAAGGGAAGAAGCCCATGTTTATGCTGCGCAAGACGAACAGCG
CGCAGGTCGACGGCGGTGATCCGGGGAGTGCGGGCATGGCGAGGGGGGGCGACGGGGTATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail