Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01722
Gene name
Locationscaffold_02:267678..268419
Strand+
Gene length (bp)741
Transcript length (bp)564
Coding sequence length (bp)564
Protein length (aa) 188

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02585 PIG-L GlcNAc-PI de-N-acetylase 2.5E-10 14 91

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.63 0.3167 0.0564 0.1831 0.6236 0.0317 0.5751 0.5467 0.2686 0.0079

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5516
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2104
Ophiocordyceps australis map64 (Brazil) OphauB2|1914
Ophiocordyceps camponoti-floridani Ophcf2|01722 (this protein)
Ophiocordyceps kimflemingae Ophio5|7947
Ophiocordyceps subramaniannii Hirsu2|678

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01722
MFFAPTLLAVTQPRCENHVRILAALLGVGCGHVDVVDDGRFPDSMTERWQVESLSKLLTSTLRCHRIDTLITFDA
TGISSHPNHRACHAASLRLPASDSDSDSDSEYPRDVYALETVSLLRKYMSVLDLLFLRGGTNAARLRFVSGWGGY
RRARAAMVTAHVSQMVWFRHLWVLFSRYMVVNELVLV*
Coding >Ophcf2|01722
ATGTTCTTCGCGCCGACGCTGCTGGCCGTGACGCAGCCTCGGTGCGAGAACCACGTCCGGATCCTTGCGGCCTTG
TTGGGGGTTGGGTGTGGGCATGTTGATGTTGTTGATGATGGGAGGTTTCCCGATTCCATGACGGAGAGGTGGCAA
GTCGAATCCCTCTCCAAGCTCCTGACCTCAACCCTACGATGCCACCGCATCGACACCCTCATCACCTTCGACGCC
ACCGGAATCTCCTCCCACCCCAACCACCGAGCCTGCCACGCCGCCTCCCTCCGCCTCCCCGCCTCGGACTCGGAC
TCGGACTCGGACTCGGAATATCCACGCGACGTTTACGCGCTGGAGACGGTCAGCCTGCTGCGCAAGTACATGTCC
GTCTTGGACCTGCTCTTCCTGCGCGGCGGGACGAACGCGGCGAGGCTGCGATTCGTTAGCGGCTGGGGGGGTTAT
CGTCGGGCGAGGGCTGCCATGGTTACGGCTCATGTCAGTCAGATGGTTTGGTTTCGGCATCTGTGGGTTTTGTTC
AGTCGGTATATGGTTGTGAATGAGTTGGTGTTGGTTTAG
Transcript >Ophcf2|01722
ATGTTCTTCGCGCCGACGCTGCTGGCCGTGACGCAGCCTCGGTGCGAGAACCACGTCCGGATCCTTGCGGCCTTG
TTGGGGGTTGGGTGTGGGCATGTTGATGTTGTTGATGATGGGAGGTTTCCCGATTCCATGACGGAGAGGTGGCAA
GTCGAATCCCTCTCCAAGCTCCTGACCTCAACCCTACGATGCCACCGCATCGACACCCTCATCACCTTCGACGCC
ACCGGAATCTCCTCCCACCCCAACCACCGAGCCTGCCACGCCGCCTCCCTCCGCCTCCCCGCCTCGGACTCGGAC
TCGGACTCGGACTCGGAATATCCACGCGACGTTTACGCGCTGGAGACGGTCAGCCTGCTGCGCAAGTACATGTCC
GTCTTGGACCTGCTCTTCCTGCGCGGCGGGACGAACGCGGCGAGGCTGCGATTCGTTAGCGGCTGGGGGGGTTAT
CGTCGGGCGAGGGCTGCCATGGTTACGGCTCATGTCAGTCAGATGGTTTGGTTTCGGCATCTGTGGGTTTTGTTC
AGTCGGTATATGGTTGTGAATGAGTTGGTGTTGGTTTAG
Gene >Ophcf2|01722
ATGTTCTTCGCGCCGACGCTGCTGGCCGTGACGCAGCCTCGGTGCGAGAACCACGTCCGGATCCTGTGCGTGACG
AGGGGGGAGGCCGGGGGTTGGGGGCGGTGCGGGCCGGGGAGTTGAAGAGGAGTGCGGCCTTGTTGGGGGTTGGGT
GTGGGCATGTTGATGTTGTTGATGATGGGTTCGTTTTTTTTTTTTTCTTTCTTTCTTTCTTCTTTCTTCTTATTT
CCCCTTGGTGAGCGAAATCTGGCTTCGTTGCTGATGAGGGGATGATGGAGATAAAAAAAAAAAAACAGGAGGTTT
CCCGATTCCATGACGGAGAGGTGGCAAGTCGAATCCCTCTCCAAGCTCCTGACCTCAACCCTACGATGCCACCGC
ATCGACACCCTCATCACCTTCGACGCCACCGGAATCTCCTCCCACCCCAACCACCGAGCCTGCCACGCCGCCTCC
CTCCGCCTCCCCGCCTCGGACTCGGACTCGGACTCGGACTCGGAATATCCACGCGACGTTTACGCGCTGGAGACG
GTCAGCCTGCTGCGCAAGTACATGTCCGTCTTGGACCTGCTCTTCCTGCGCGGCGGGACGAACGCGGCGAGGCTG
CGATTCGTTAGCGGCTGGGGGGGTTATCGTCGGGCGAGGGCTGCCATGGTTACGGCTCATGTCAGTCAGATGGTT
TGGTTTCGGCATCTGTGGGTTTTGTTCAGTCGGTATATGGTTGTGAATGAGTTGGTGTTGGTTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail