Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01720
Gene name
Locationscaffold_02:263038..266046
Strand+
Gene length (bp)3008
Transcript length (bp)2934
Coding sequence length (bp)2934
Protein length (aa) 978

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08619 Nha1_C Alkali metal cation/H+ antiporter Nha1 C terminus 7.2E-127 458 950
PF00999 Na_H_Exchanger Sodium/hydrogen exchanger family 3.4E-78 16 433

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0015299 solute:proton antiporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0015385 sodium:proton antiporter activity Yes
GO:0006814 sodium ion transport Yes
GO:0006812 cation transport Yes
GO:0055085 transmembrane transport Yes
GO:0046873 metal ion transmembrane transporter activity No
GO:0015298 solute:cation antiporter activity No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0051179 localization No
GO:0009987 cellular process No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0006810 transport No
GO:0015491 cation:cation antiporter activity No
GO:0022857 transmembrane transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0022804 active transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0015081 sodium ion transmembrane transporter activity No
GO:0051139 metal ion:proton antiporter activity No
GO:0006811 ion transport No
GO:0015291 secondary active transmembrane transporter activity No
GO:0015078 proton transmembrane transporter activity No
GO:0008324 cation transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0015297 antiporter activity No
GO:0005451 monovalent cation:proton antiporter activity No
GO:0003674 molecular_function No
GO:0022853 active ion transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0030001 metal ion transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.5

Transmembrane Domains

Domain # Start End Length
1 13 32 19
2 102 124 22
3 134 153 19
4 174 193 19
5 203 225 22
6 246 265 19
7 293 315 22
8 327 349 22
9 364 386 22
10 406 428 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01720
MAWSHLDITEPHLVYIILGGFTSLFMLCSSFIKERMYIGEATVATLCGVIFGPHAANLIDPEKWGNTDIVTLEFS
RIVLVVQCFAVGVELPKFYMERHWRSVVLLLVPVMTFGWLIVSLFIWWMIPPLNWLDSLVVAACVTATDPVLASS
VVGKGKFAKRVPKHLRDLLSAESGCNDGMAFPFIYLSLYLIQYNKNAGKVSYYFVVYVILYECIFGAIFGFVIGY
IARHGIKYSEKHDLIDRESFLVFYFALALFCAGSGSILGLDDLLVGFTAGVGFSNDGWFGEKTEESHVSNVIDLL
LNLTYFVYFGTIIPWEQYNNGVFGLKAWRLVVIAIFVLLFRRIPIMLALKPLIPDIKNWREALFAGHFGPIGVGA
IFVAILARAELEHHESVPLPMLPPEDSENYALIYLVWPIVTFLVISSILVHGSSVAVFTLGKRINTLSLTMSYTA
APDDATNWMNRLPRISSQSRSQAKTASDASFDDDKDPELPPGALMPPLGFLRRQRDDDNVPSRSGSRASSLVSKR
RKHSGRRWDDGIGPGGPVSQSAIFPSRPTPGTGGGGAVLQETLSPPARENTDSTLSGGSGKKDPERPEDGDNGEG
EQRHGERAPRVQVYAEGDDVVVEDESGDVLDVDSAHQRSEEVSDAEEEEAGGDAGEEASIWTLHGFRRKMSDMYT
SEMEKRKGKANAQRRHEPARAYQFGSMIIVEDEDGEVVKSYQLPSQRDQEGGEPSNDLLGSSLKYLGLGAKNRQG
EKSAEEAAEEGKAGMSASTSPAGRPSGWPGFGRSVAQRRTFAQQQEADDDKKIRFTIGGVGRRMTKDDFIRQVQN
LDALTRKEVVDQSTASTAVKNLARQDPPPQQQKQQQQQQKQQQQQQQHETGGPSSRREAQQSGSAWHDESEPVSP
DETAVERRRRLAVLSSQADETEDTGETPAERRRRQAALGMEGPAAGDDSDDEGTERVPPARRGIRFAEPRRDGRG
SG*
Coding >Ophcf2|01720
ATGGCCTGGTCTCACCTAGACATCACCGAGCCGCACCTCGTCTACATCATCCTCGGCGGCTTCACCTCCCTCTTC
ATGCTATGCTCCTCCTTCATCAAGGAGCGCATGTACATTGGTGAAGCCACCGTCGCCACCCTCTGCGGCGTCATC
TTCGGCCCGCACGCCGCCAACCTCATCGACCCGGAGAAATGGGGCAACACCGACATCGTCACCCTCGAATTCTCC
CGAATCGTCCTCGTCGTACAATGTTTCGCCGTCGGCGTCGAACTGCCCAAGTTTTACATGGAGAGGCATTGGCGC
TCCGTCGTCTTGCTGCTCGTTCCCGTCATGACCTTTGGCTGGCTCATCGTCAGCCTCTTCATCTGGTGGATGATC
CCACCCCTCAATTGGCTCGATTCCCTCGTCGTCGCCGCTTGTGTCACGGCTACCGATCCCGTCCTCGCTTCCTCC
GTCGTCGGAAAGGGCAAGTTTGCTAAGCGCGTGCCCAAGCATCTTCGCGACCTTCTCTCGGCCGAGTCGGGCTGC
AACGACGGTATGGCCTTTCCTTTCATCTACCTCTCCCTCTACCTGATTCAGTACAACAAAAACGCCGGCAAGGTC
AGCTATTACTTCGTCGTCTACGTCATCCTATACGAGTGCATCTTCGGCGCCATCTTTGGCTTCGTCATCGGCTAC
ATCGCCCGTCACGGCATCAAGTATTCCGAGAAGCACGACCTCATCGATCGTGAGAGCTTCCTCGTCTTCTACTTC
GCCCTCGCTCTCTTCTGCGCCGGTTCCGGCAGTATCCTCGGCCTCGACGACCTCCTCGTCGGCTTCACCGCCGGT
GTCGGCTTCTCCAACGACGGCTGGTTCGGCGAAAAGACGGAGGAGTCGCACGTGTCCAACGTCATCGACCTGCTG
CTCAACCTGACCTACTTTGTCTACTTTGGCACCATAATCCCGTGGGAGCAGTACAACAACGGCGTCTTCGGTCTC
AAGGCCTGGCGCCTCGTCGTCATCGCCATCTTCGTCCTGCTCTTCCGTCGCATCCCCATCATGCTGGCTCTCAAG
CCCCTGATACCGGATATAAAGAACTGGCGCGAGGCCCTTTTCGCCGGTCACTTTGGTCCCATCGGCGTCGGCGCC
ATCTTCGTCGCCATTCTCGCCCGCGCCGAGCTCGAACACCACGAGTCGGTCCCCTTGCCGATGCTGCCACCCGAG
GATTCGGAGAACTATGCGCTCATCTACCTCGTCTGGCCCATCGTCACCTTTCTCGTCATCTCCTCCATCCTCGTC
CACGGCTCATCCGTCGCCGTCTTCACGCTGGGGAAGCGCATCAACACGCTGTCGCTGACCATGTCGTACACGGCC
GCTCCGGACGACGCCACCAACTGGATGAACAGACTGCCGCGCATCTCGTCCCAGTCGCGCTCCCAGGCCAAGACG
GCTTCGGACGCCTCATTCGACGACGACAAGGACCCTGAGCTGCCACCGGGCGCCCTGATGCCGCCTCTGGGCTTC
CTGCGCCGTCAGAGAGACGATGACAACGTCCCGAGCCGCAGCGGAAGCCGGGCCTCTTCCCTCGTGTCCAAGAGG
CGCAAGCACAGCGGCAGGAGGTGGGACGACGGCATCGGTCCCGGAGGCCCCGTCAGCCAGTCGGCCATCTTCCCG
AGTCGGCCGACGCCCGGCACCGGCGGCGGCGGGGCCGTCCTTCAGGAGACGCTGTCACCGCCCGCGCGCGAAAAC
ACCGACTCGACGCTGTCCGGGGGCAGCGGCAAGAAGGATCCGGAGAGGCCGGAGGACGGCGACAACGGCGAGGGA
GAGCAGCGGCACGGCGAACGGGCGCCCCGCGTGCAAGTGTACGCCGAGGGAGACGACGTCGTAGTGGAAGACGAG
AGCGGCGACGTGCTGGACGTCGATTCAGCCCACCAGCGGAGCGAGGAGGTCTCCGACGCGGAAGAGGAGGAGGCT
GGCGGTGACGCGGGCGAGGAGGCCTCCATCTGGACGCTGCACGGGTTCCGACGTAAGATGAGCGACATGTACACT
TCGGAGATGGAGAAGCGCAAGGGCAAGGCCAACGCTCAGCGGCGACACGAGCCGGCGCGGGCCTATCAGTTTGGC
AGCATGATCATCGTCGAGGACGAAGACGGCGAGGTTGTCAAGTCGTACCAGCTGCCTTCGCAGAGAGACCAGGAG
GGGGGCGAACCGAGCAACGACCTCCTCGGAAGCAGCCTCAAGTATCTCGGTCTCGGGGCCAAGAACCGCCAAGGC
GAAAAGAGCGCGGAAGAAGCGGCAGAAGAGGGGAAAGCCGGCATGAGCGCCTCTACTTCTCCCGCTGGCAGACCG
TCTGGATGGCCCGGGTTCGGCAGGTCAGTGGCGCAGAGGAGGACGTTTGCGCAGCAGCAGGAGGCCGACGACGAT
AAGAAGATTCGCTTCACTATCGGGGGCGTCGGACGGCGGATGACCAAGGACGACTTCATCCGCCAGGTGCAGAAT
CTGGATGCCCTGACGCGTAAGGAGGTGGTGGATCAGTCGACGGCCTCGACGGCAGTCAAGAATCTGGCGAGACAA
GATCCGCCACCGCAGCAGCAGAAGCAGCAGCAACAACAGCAGAAGCAGCAGCAGCAGCAGCAGCAGCACGAGACA
GGCGGTCCATCATCGAGACGGGAAGCGCAACAGAGCGGCAGCGCATGGCACGACGAATCGGAGCCCGTATCTCCG
GACGAGACGGCGGTGGAACGTCGACGACGACTGGCCGTCCTCTCGAGTCAGGCGGACGAAACCGAGGACACGGGC
GAGACACCGGCCGAGAGGCGGAGGCGACAGGCGGCTCTGGGCATGGAGGGACCGGCGGCGGGAGACGATAGCGAC
GATGAGGGGACGGAGAGGGTGCCGCCGGCTCGGAGGGGGATTCGCTTTGCTGAGCCGAGGAGGGACGGGAGGGGG
AGTGGATAG
Transcript >Ophcf2|01720
ATGGCCTGGTCTCACCTAGACATCACCGAGCCGCACCTCGTCTACATCATCCTCGGCGGCTTCACCTCCCTCTTC
ATGCTATGCTCCTCCTTCATCAAGGAGCGCATGTACATTGGTGAAGCCACCGTCGCCACCCTCTGCGGCGTCATC
TTCGGCCCGCACGCCGCCAACCTCATCGACCCGGAGAAATGGGGCAACACCGACATCGTCACCCTCGAATTCTCC
CGAATCGTCCTCGTCGTACAATGTTTCGCCGTCGGCGTCGAACTGCCCAAGTTTTACATGGAGAGGCATTGGCGC
TCCGTCGTCTTGCTGCTCGTTCCCGTCATGACCTTTGGCTGGCTCATCGTCAGCCTCTTCATCTGGTGGATGATC
CCACCCCTCAATTGGCTCGATTCCCTCGTCGTCGCCGCTTGTGTCACGGCTACCGATCCCGTCCTCGCTTCCTCC
GTCGTCGGAAAGGGCAAGTTTGCTAAGCGCGTGCCCAAGCATCTTCGCGACCTTCTCTCGGCCGAGTCGGGCTGC
AACGACGGTATGGCCTTTCCTTTCATCTACCTCTCCCTCTACCTGATTCAGTACAACAAAAACGCCGGCAAGGTC
AGCTATTACTTCGTCGTCTACGTCATCCTATACGAGTGCATCTTCGGCGCCATCTTTGGCTTCGTCATCGGCTAC
ATCGCCCGTCACGGCATCAAGTATTCCGAGAAGCACGACCTCATCGATCGTGAGAGCTTCCTCGTCTTCTACTTC
GCCCTCGCTCTCTTCTGCGCCGGTTCCGGCAGTATCCTCGGCCTCGACGACCTCCTCGTCGGCTTCACCGCCGGT
GTCGGCTTCTCCAACGACGGCTGGTTCGGCGAAAAGACGGAGGAGTCGCACGTGTCCAACGTCATCGACCTGCTG
CTCAACCTGACCTACTTTGTCTACTTTGGCACCATAATCCCGTGGGAGCAGTACAACAACGGCGTCTTCGGTCTC
AAGGCCTGGCGCCTCGTCGTCATCGCCATCTTCGTCCTGCTCTTCCGTCGCATCCCCATCATGCTGGCTCTCAAG
CCCCTGATACCGGATATAAAGAACTGGCGCGAGGCCCTTTTCGCCGGTCACTTTGGTCCCATCGGCGTCGGCGCC
ATCTTCGTCGCCATTCTCGCCCGCGCCGAGCTCGAACACCACGAGTCGGTCCCCTTGCCGATGCTGCCACCCGAG
GATTCGGAGAACTATGCGCTCATCTACCTCGTCTGGCCCATCGTCACCTTTCTCGTCATCTCCTCCATCCTCGTC
CACGGCTCATCCGTCGCCGTCTTCACGCTGGGGAAGCGCATCAACACGCTGTCGCTGACCATGTCGTACACGGCC
GCTCCGGACGACGCCACCAACTGGATGAACAGACTGCCGCGCATCTCGTCCCAGTCGCGCTCCCAGGCCAAGACG
GCTTCGGACGCCTCATTCGACGACGACAAGGACCCTGAGCTGCCACCGGGCGCCCTGATGCCGCCTCTGGGCTTC
CTGCGCCGTCAGAGAGACGATGACAACGTCCCGAGCCGCAGCGGAAGCCGGGCCTCTTCCCTCGTGTCCAAGAGG
CGCAAGCACAGCGGCAGGAGGTGGGACGACGGCATCGGTCCCGGAGGCCCCGTCAGCCAGTCGGCCATCTTCCCG
AGTCGGCCGACGCCCGGCACCGGCGGCGGCGGGGCCGTCCTTCAGGAGACGCTGTCACCGCCCGCGCGCGAAAAC
ACCGACTCGACGCTGTCCGGGGGCAGCGGCAAGAAGGATCCGGAGAGGCCGGAGGACGGCGACAACGGCGAGGGA
GAGCAGCGGCACGGCGAACGGGCGCCCCGCGTGCAAGTGTACGCCGAGGGAGACGACGTCGTAGTGGAAGACGAG
AGCGGCGACGTGCTGGACGTCGATTCAGCCCACCAGCGGAGCGAGGAGGTCTCCGACGCGGAAGAGGAGGAGGCT
GGCGGTGACGCGGGCGAGGAGGCCTCCATCTGGACGCTGCACGGGTTCCGACGTAAGATGAGCGACATGTACACT
TCGGAGATGGAGAAGCGCAAGGGCAAGGCCAACGCTCAGCGGCGACACGAGCCGGCGCGGGCCTATCAGTTTGGC
AGCATGATCATCGTCGAGGACGAAGACGGCGAGGTTGTCAAGTCGTACCAGCTGCCTTCGCAGAGAGACCAGGAG
GGGGGCGAACCGAGCAACGACCTCCTCGGAAGCAGCCTCAAGTATCTCGGTCTCGGGGCCAAGAACCGCCAAGGC
GAAAAGAGCGCGGAAGAAGCGGCAGAAGAGGGGAAAGCCGGCATGAGCGCCTCTACTTCTCCCGCTGGCAGACCG
TCTGGATGGCCCGGGTTCGGCAGGTCAGTGGCGCAGAGGAGGACGTTTGCGCAGCAGCAGGAGGCCGACGACGAT
AAGAAGATTCGCTTCACTATCGGGGGCGTCGGACGGCGGATGACCAAGGACGACTTCATCCGCCAGGTGCAGAAT
CTGGATGCCCTGACGCGTAAGGAGGTGGTGGATCAGTCGACGGCCTCGACGGCAGTCAAGAATCTGGCGAGACAA
GATCCGCCACCGCAGCAGCAGAAGCAGCAGCAACAACAGCAGAAGCAGCAGCAGCAGCAGCAGCAGCACGAGACA
GGCGGTCCATCATCGAGACGGGAAGCGCAACAGAGCGGCAGCGCATGGCACGACGAATCGGAGCCCGTATCTCCG
GACGAGACGGCGGTGGAACGTCGACGACGACTGGCCGTCCTCTCGAGTCAGGCGGACGAAACCGAGGACACGGGC
GAGACACCGGCCGAGAGGCGGAGGCGACAGGCGGCTCTGGGCATGGAGGGACCGGCGGCGGGAGACGATAGCGAC
GATGAGGGGACGGAGAGGGTGCCGCCGGCTCGGAGGGGGATTCGCTTTGCTGAGCCGAGGAGGGACGGGAGGGGG
AGTGGATAG
Gene >Ophcf2|01720
ATGGCCTGGTCTCACCTAGACATCACCGAGCCGCACCTCGTCTACATCATCCTCGGCGGCTTCACCTCCCTCTTC
ATGCTATGCTCCTCCTTCATCAAGGAGCGCATGTACATTGGTGAAGCCACCGTCGCCACCCTCTGCGGCGTCATC
TTCGGCCCGCACGCCGCCAACCTCATCGACCCGGAGAAATGGGGCAACACCGACATCGTCACCCTCGAATTCTCC
CGAATCGTCCTCGTCGTACAATGTTTCGCCGTCGGCGTCGAACTGCCCAAGTTTTACATGGAGAGGCATTGGCGC
TCCGTCGTCTTGCTGCTCGTTCCCGTCATGACCTTTGGCTGGCTCATCGTCAGCCTCTTCATCTGGTGGATGATC
CCACCCCTCAATTGGCTCGATTCCCTCGTCGTCGCCGCTTGTGTCACGGCTACCGATCCCGTCCTCGCTTCCTCC
GTCGTCGGAAAGGGCAAGTTTGCTAAGCGCGTGCCCAAGCATCTTCGCGACCTTCTCTCGGCCGAGTCGGGCTGC
AACGACGGTATGGCCTTTCCTTTCATCTACCTCTCCCTCTACCTGATTCAGTACAACAAAAACGCCGGCAAGGTC
AGCTATTACTTCGTCGTCTACGTCATCCTATACGAGTGCATCTTCGGCGCCATCTTTGGCTTCGTCATCGGCTAC
ATCGCCCGTCACGGCATCAAGTATTCCGAGAAGCACGACCTCATCGATCGTGAGAGCTTCCTCGTCTTCTACTTC
GCCCTCGCTCTCTTCTGCGCCGGTTCCGGCAGTATCCTCGGCCTCGACGACCTCCTCGTCGGCTTCACCGCCGGT
GTCGGCTTCTCCAACGACGGCTGGTTCGGCGAAAAGACGGAGGAGTCGCACGTGTCCAACGTCATCGACCTGCTG
CTCAACCTGACCTACTTTGTCTACTTTGGCACCATAATCCCGTGGGAGCAGTACAACAACGGCGTCTTCGGTCTC
AAGGCCTGGCGCCTCGTCGTCATCGCCATCTTCGTCCTGCTCTTCCGTCGCATCCCCATCATGCTGGCTCTCAAG
CCCCTGATACCGGATATAAAGAACTGGCGCGAGGCCCTTTTCGCCGGTCACTTTGGTCCCATCGGCGTCGGCGCC
ATCTTCGTCGCCATTCTCGCCCGCGCCGAGCTCGAACACCACGAGTCGGTCCCCTTGCCGATGCTGCCACCCGAG
GATTCGGAGAACTATGCGCTCATCTACCTCGTCTGGCCCATCGTCACCTTTCTCGTCATCTCCTCCATCCTCGTC
CACGGCTCATCCGTCGCCGTCTTCACGCTGGGGAAGCGCATCAACACGCTGTCGCTGACCATGTCGTACACGGCC
GCTCCGGACGACGCCACCAACTGGATGAACAGACTGCCGCGCATCTCGTCCCAGTCGCGCTCCCAGGCCAAGACG
GCTTCGGACGCCTCATTCGACGACGACAAGGACCCTGAGCTGCCACCGGGCGCCCTGATGCCGCCTCTGGGCTTC
CTGCGCCGTCAGAGAGACGATGACAACGTCCCGAGCCGCAGCGGAAGCCGGGCCTCTTCCCTCGTGTCCAAGAGG
CGCAAGCACAGCGGCAGGAGGTGGGACGACGGCATCGGTCCCGGAGGCCCCGTCAGCCAGTCGGCCATCTTCCCG
AGTCGGCCGACGCCCGGCACCGGCGGCGGCGGGGCCGTCCTTCAGGAGACGCTGTCACCGCCCGCGCGCGAAAAC
ACCGACTCGACGCTGTCCGGGGGCAGCGGCAAGAAGGATCCGGAGAGGCCGGAGGACGGCGACAACGGCGAGGGA
GAGCAGCGGCACGGCGAACGGGCGCCCCGCGTGCAAGTGTACGCCGAGGGAGACGACGTCGTAGTGGAAGACGAG
AGCGGCGACGTGCTGGACGTCGATTCAGCCCACCAGCGGAGCGAGGAGGTCTCCGACGCGGAAGAGGAGGAGGCT
GGCGGTGACGCGGGCGAGGAGGCCTCCATCTGGACGCTGCACGGGTTCCGACGTAAGATGAGCGACATGTACACT
TCGGAGATGGAGAAGCGCAAGGGCAAGGCCAACGCTCAGCGGCGACACGAGCCGGCGCGGGCCTATCAGTTTGGC
AGCATGGTGAGTTCTACTTCTCTGCGTCATGATTTGTCTCGTCTCGTCTCATCGAAGCTGACTGGACCGGACACG
TGTAGATCATCGTCGAGGACGAAGACGGCGAGGTTGTCAAGTCGTACCAGCTGCCTTCGCAGAGAGACCAGGAGG
GGGGCGAACCGAGCAACGACCTCCTCGGAAGCAGCCTCAAGTATCTCGGTCTCGGGGCCAAGAACCGCCAAGGCG
AAAAGAGCGCGGAAGAAGCGGCAGAAGAGGGGAAAGCCGGCATGAGCGCCTCTACTTCTCCCGCTGGCAGACCGT
CTGGATGGCCCGGGTTCGGCAGGTCAGTGGCGCAGAGGAGGACGTTTGCGCAGCAGCAGGAGGCCGACGACGATA
AGAAGATTCGCTTCACTATCGGGGGCGTCGGACGGCGGATGACCAAGGACGACTTCATCCGCCAGGTGCAGAATC
TGGATGCCCTGACGCGTAAGGAGGTGGTGGATCAGTCGACGGCCTCGACGGCAGTCAAGAATCTGGCGAGACAAG
ATCCGCCACCGCAGCAGCAGAAGCAGCAGCAACAACAGCAGAAGCAGCAGCAGCAGCAGCAGCAGCACGAGACAG
GCGGTCCATCATCGAGACGGGAAGCGCAACAGAGCGGCAGCGCATGGCACGACGAATCGGAGCCCGTATCTCCGG
ACGAGACGGCGGTGGAACGTCGACGACGACTGGCCGTCCTCTCGAGTCAGGCGGACGAAACCGAGGACACGGGCG
AGACACCGGCCGAGAGGCGGAGGCGACAGGCGGCTCTGGGCATGGAGGGACCGGCGGCGGGAGACGATAGCGACG
ATGAGGGGACGGAGAGGGTGCCGCCGGCTCGGAGGGGGATTCGCTTTGCTGAGCCGAGGAGGGACGGGAGGGGGA
GTGGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail