Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01716
Gene name
Locationscaffold_02:242915..245932
Strand-
Gene length (bp)3017
Transcript length (bp)2919
Coding sequence length (bp)2919
Protein length (aa) 973

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02752 Arrestin_C Arrestin (or S-antigen), C-terminal domain 1.2E-18 529 745

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear export signal 0.6952 0.3479 0.1543 0.2497 0.1441 0.0022 0.083 0.1686 0.1407 0.0643

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1074
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2510
Ophiocordyceps australis map64 (Brazil) OphauB2|4159
Ophiocordyceps camponoti-floridani Ophcf2|01716 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6959
Ophiocordyceps kimflemingae Ophio5|4312
Ophiocordyceps subramaniannii Hirsu2|10051

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01716
MVDSIPAPSQPRSRNGNWVISSGGNVFYRVDGRSQPPAPALPAPLIGPRRTRPHAIHIITYPPGYIPRELRPKTP
SRSKKAAQSLRARTLLGRGDLNDGSPQQAPGLSKLLASFARPTAAVDPRLIPVIEPRLPAYDDVAATDRRQQNRL
SLPLPLSLRRPDDSSSSSRPHTTERSLTAPPPFNMAHARAAHSVAAPHAPVAPPAAYRIGGAAAAANVNRNGLMS
VRSAKSAVSHLVAEVPKPVASGSGVSCSILLAEPNIFLSGFDHDHDPQRDSSGGTALLRGKLHLSVSKNVKIKAI
QLKLLGRARTEWPEGIPPLKQDVVEEESLRTQVLTFFNAMNDGWETEYGNQCSFRLRVASTNSSNTNLAAAPRGP
GGGPGGGGGGGGGGGGGAAAGAGAGAAGGGLTPAMAAHRSGLTAKELKRLSLQSVQSRSFGKGDSGLASPTQAKG
FKVFHPGSYDYSFELPIDHHQLETTKLPFGSVRWELHATVDRAGAFKPNLHGMKEVSIVRLPDQMSLETTEPISI
SRQWEDQLHYDIVISGKSFPIGSKIPIAFKLTPLAKVQVHKLKVYVTETIEYWTNDRRVTRKEPGRKILLLEKSA
GKPLDAAWAASDITTIRGGEPSAEERRNARELAQRRRAADAARRHRTPEPLPDSSANLLGDLDLGLESMWGSTEI
EANVQIPTCEMMAKNKHQRLNPDCSWRNVNVYHWIKIVMRISRADPEDPTGHKRRHFEISIDSPFTVLNCRATQA
NTNLPAYSGPVSQPSPFQACCGCPDAASVPTNMSPSSSTGTLLGGEPLMGDAMPTPPQAAHMGPMMITELRPSTR
ASAEGSGSQGDARPIHLLRTPSFDPPAFTADIAPPPAIVIDVPDASTPPPQYDTVIGTPSVDGLADYFSRLADYG
YHDDDDSGSDSDILPSRILDRTGRVNVAHPRTSRSGRRMPSRSMEIARPSVSLNLENLPDPNRGALLPGHVM*
Coding >Ophcf2|01716
ATGGTTGACTCTATACCAGCCCCGTCCCAGCCGCGGTCCCGCAACGGCAACTGGGTCATCTCCAGCGGAGGAAAC
GTCTTCTACCGCGTCGACGGCCGATCTCAACCTCCGGCTCCGGCTCTTCCGGCGCCGCTCATCGGGCCCCGCCGC
ACCAGGCCGCACGCCATCCACATCATCACTTACCCTCCCGGATACATCCCCCGAGAGCTGCGGCCCAAAACCCCG
AGCAGATCTAAGAAGGCGGCTCAGTCGCTCCGGGCTCGGACCCTCCTCGGCCGCGGTGACTTGAACGACGGCAGC
CCTCAGCAGGCCCCCGGCTTGAGCAAGCTGCTCGCCTCGTTTGCCCGACCGACCGCCGCCGTCGATCCCCGGCTG
ATCCCGGTCATCGAGCCCCGGCTTCCGGCCTACGACGACGTAGCCGCCACCGATCGTCGCCAGCAGAACCGTCTC
AGCTTGCCTCTCCCGCTGTCCCTGCGACGACCCGACGACAGCTCCTCCTCGTCAAGGCCACACACCACGGAGCGC
TCCCTCACGGCCCCTCCACCCTTCAACATGGCTCACGCCCGCGCCGCTCACTCCGTCGCCGCTCCGCACGCGCCC
GTCGCCCCCCCGGCAGCCTACCGCATCGGGGGCGCCGCCGCCGCCGCCAACGTCAACCGCAACGGCCTCATGTCG
GTACGGTCCGCCAAGTCGGCTGTCAGCCACCTGGTGGCCGAGGTGCCCAAGCCCGTCGCCTCCGGAAGCGGCGTC
TCGTGCTCCATCCTGTTGGCCGAGCCCAACATCTTCCTCTCCGGCTTCGACCACGATCACGACCCTCAGCGCGAC
TCGAGCGGCGGCACCGCCCTGCTCCGCGGCAAGCTGCACCTCTCGGTCAGTAAGAATGTCAAGATCAAGGCCATC
CAGCTCAAGCTGCTCGGACGCGCCCGCACCGAGTGGCCCGAGGGCATCCCCCCGCTCAAGCAGGACGTGGTCGAG
GAGGAGAGCCTGCGGACTCAGGTCTTGACCTTTTTCAACGCCATGAACGATGGCTGGGAGACCGAGTATGGCAAT
CAGTGTTCCTTTAGGCTCCGCGTCGCCTCGACCAACTCGAGCAACACCAACCTCGCCGCCGCGCCCCGAGGACCT
GGTGGAGGACCGGGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGCAGCAGCAGGAGCAGGAGCAGGA
GCAGCAGGAGGAGGTCTGACGCCCGCCATGGCGGCTCACCGCAGCGGCCTCACCGCAAAGGAGCTCAAGCGCCTC
TCCCTACAGAGCGTCCAGTCCCGCAGCTTCGGAAAGGGAGACAGCGGTCTCGCCTCGCCCACCCAGGCCAAGGGA
TTCAAGGTCTTTCACCCGGGCTCGTACGACTACTCGTTCGAGCTGCCCATCGACCATCACCAGCTCGAGACGACC
AAGCTGCCCTTTGGCTCCGTCCGCTGGGAACTGCACGCCACCGTCGACCGCGCCGGGGCTTTCAAGCCGAACCTC
CACGGCATGAAGGAGGTGTCCATCGTCCGGCTACCGGACCAGATGTCGCTCGAGACGACGGAGCCCATCTCCATC
AGCCGCCAGTGGGAGGACCAGCTTCACTACGACATCGTCATCTCGGGCAAGAGTTTCCCGATAGGCTCCAAGATC
CCCATCGCCTTCAAGCTCACGCCGCTGGCCAAGGTGCAGGTACACAAGCTCAAGGTGTACGTGACGGAGACGATC
GAGTACTGGACCAACGATCGGCGCGTCACCCGCAAGGAGCCCGGCCGCAAGATCCTGCTACTGGAGAAGTCGGCC
GGGAAGCCGCTCGATGCCGCCTGGGCCGCCTCGGACATCACCACCATCCGCGGAGGGGAGCCGAGCGCGGAGGAA
CGGCGCAACGCCAGGGAGCTGGCTCAGCGGAGGCGGGCGGCCGACGCGGCCCGTCGACACCGGACGCCGGAGCCC
CTCCCGGACTCGTCGGCCAACCTCCTCGGCGACCTGGATCTCGGGCTGGAGAGCATGTGGGGATCTACGGAGATT
GAGGCCAACGTGCAGATTCCGACGTGCGAGATGATGGCCAAGAACAAGCATCAGAGGCTGAACCCGGACTGCAGC
TGGCGGAACGTCAACGTCTATCACTGGATCAAGATCGTCATGCGCATCAGCCGCGCGGACCCCGAGGATCCTACC
GGTCACAAGAGACGCCACTTCGAGATCAGTATCGACTCGCCCTTTACCGTCCTCAACTGCCGAGCCACGCAGGCC
AACACGAACCTTCCGGCCTATTCGGGCCCCGTCAGCCAGCCGTCGCCCTTCCAGGCCTGCTGCGGCTGCCCGGAC
GCCGCCTCGGTGCCGACCAACATGTCGCCCAGCTCGTCGACGGGCACGCTTCTGGGCGGTGAGCCGCTCATGGGC
GACGCCATGCCCACGCCTCCGCAAGCGGCTCACATGGGTCCCATGATGATTACGGAATTGCGGCCCTCGACGCGT
GCTTCGGCCGAGGGGAGCGGCTCTCAGGGCGACGCCCGGCCCATCCACCTCTTGAGGACGCCCAGCTTCGATCCG
CCCGCCTTTACGGCCGACATTGCACCTCCGCCGGCCATCGTCATCGACGTGCCCGACGCGTCGACGCCGCCTCCG
CAGTACGACACCGTCATCGGCACGCCCAGCGTCGACGGTCTGGCCGATTACTTCTCGCGGTTGGCCGACTATGGT
TATCACGACGACGACGATTCGGGCTCAGACTCGGATATCTTGCCTTCGAGGATCCTGGATAGGACGGGGAGGGTC
AACGTCGCGCATCCGAGGACGTCTCGCTCGGGGAGGAGGATGCCGAGTCGGAGTATGGAGATTGCTCGTCCGTCT
GTCAGTCTAAACCTGGAGAATCTGCCGGATCCGAATAGGGGGGCACTCTTGCCGGGGCACGTCATGTAG
Transcript >Ophcf2|01716
ATGGTTGACTCTATACCAGCCCCGTCCCAGCCGCGGTCCCGCAACGGCAACTGGGTCATCTCCAGCGGAGGAAAC
GTCTTCTACCGCGTCGACGGCCGATCTCAACCTCCGGCTCCGGCTCTTCCGGCGCCGCTCATCGGGCCCCGCCGC
ACCAGGCCGCACGCCATCCACATCATCACTTACCCTCCCGGATACATCCCCCGAGAGCTGCGGCCCAAAACCCCG
AGCAGATCTAAGAAGGCGGCTCAGTCGCTCCGGGCTCGGACCCTCCTCGGCCGCGGTGACTTGAACGACGGCAGC
CCTCAGCAGGCCCCCGGCTTGAGCAAGCTGCTCGCCTCGTTTGCCCGACCGACCGCCGCCGTCGATCCCCGGCTG
ATCCCGGTCATCGAGCCCCGGCTTCCGGCCTACGACGACGTAGCCGCCACCGATCGTCGCCAGCAGAACCGTCTC
AGCTTGCCTCTCCCGCTGTCCCTGCGACGACCCGACGACAGCTCCTCCTCGTCAAGGCCACACACCACGGAGCGC
TCCCTCACGGCCCCTCCACCCTTCAACATGGCTCACGCCCGCGCCGCTCACTCCGTCGCCGCTCCGCACGCGCCC
GTCGCCCCCCCGGCAGCCTACCGCATCGGGGGCGCCGCCGCCGCCGCCAACGTCAACCGCAACGGCCTCATGTCG
GTACGGTCCGCCAAGTCGGCTGTCAGCCACCTGGTGGCCGAGGTGCCCAAGCCCGTCGCCTCCGGAAGCGGCGTC
TCGTGCTCCATCCTGTTGGCCGAGCCCAACATCTTCCTCTCCGGCTTCGACCACGATCACGACCCTCAGCGCGAC
TCGAGCGGCGGCACCGCCCTGCTCCGCGGCAAGCTGCACCTCTCGGTCAGTAAGAATGTCAAGATCAAGGCCATC
CAGCTCAAGCTGCTCGGACGCGCCCGCACCGAGTGGCCCGAGGGCATCCCCCCGCTCAAGCAGGACGTGGTCGAG
GAGGAGAGCCTGCGGACTCAGGTCTTGACCTTTTTCAACGCCATGAACGATGGCTGGGAGACCGAGTATGGCAAT
CAGTGTTCCTTTAGGCTCCGCGTCGCCTCGACCAACTCGAGCAACACCAACCTCGCCGCCGCGCCCCGAGGACCT
GGTGGAGGACCGGGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGCAGCAGCAGGAGCAGGAGCAGGA
GCAGCAGGAGGAGGTCTGACGCCCGCCATGGCGGCTCACCGCAGCGGCCTCACCGCAAAGGAGCTCAAGCGCCTC
TCCCTACAGAGCGTCCAGTCCCGCAGCTTCGGAAAGGGAGACAGCGGTCTCGCCTCGCCCACCCAGGCCAAGGGA
TTCAAGGTCTTTCACCCGGGCTCGTACGACTACTCGTTCGAGCTGCCCATCGACCATCACCAGCTCGAGACGACC
AAGCTGCCCTTTGGCTCCGTCCGCTGGGAACTGCACGCCACCGTCGACCGCGCCGGGGCTTTCAAGCCGAACCTC
CACGGCATGAAGGAGGTGTCCATCGTCCGGCTACCGGACCAGATGTCGCTCGAGACGACGGAGCCCATCTCCATC
AGCCGCCAGTGGGAGGACCAGCTTCACTACGACATCGTCATCTCGGGCAAGAGTTTCCCGATAGGCTCCAAGATC
CCCATCGCCTTCAAGCTCACGCCGCTGGCCAAGGTGCAGGTACACAAGCTCAAGGTGTACGTGACGGAGACGATC
GAGTACTGGACCAACGATCGGCGCGTCACCCGCAAGGAGCCCGGCCGCAAGATCCTGCTACTGGAGAAGTCGGCC
GGGAAGCCGCTCGATGCCGCCTGGGCCGCCTCGGACATCACCACCATCCGCGGAGGGGAGCCGAGCGCGGAGGAA
CGGCGCAACGCCAGGGAGCTGGCTCAGCGGAGGCGGGCGGCCGACGCGGCCCGTCGACACCGGACGCCGGAGCCC
CTCCCGGACTCGTCGGCCAACCTCCTCGGCGACCTGGATCTCGGGCTGGAGAGCATGTGGGGATCTACGGAGATT
GAGGCCAACGTGCAGATTCCGACGTGCGAGATGATGGCCAAGAACAAGCATCAGAGGCTGAACCCGGACTGCAGC
TGGCGGAACGTCAACGTCTATCACTGGATCAAGATCGTCATGCGCATCAGCCGCGCGGACCCCGAGGATCCTACC
GGTCACAAGAGACGCCACTTCGAGATCAGTATCGACTCGCCCTTTACCGTCCTCAACTGCCGAGCCACGCAGGCC
AACACGAACCTTCCGGCCTATTCGGGCCCCGTCAGCCAGCCGTCGCCCTTCCAGGCCTGCTGCGGCTGCCCGGAC
GCCGCCTCGGTGCCGACCAACATGTCGCCCAGCTCGTCGACGGGCACGCTTCTGGGCGGTGAGCCGCTCATGGGC
GACGCCATGCCCACGCCTCCGCAAGCGGCTCACATGGGTCCCATGATGATTACGGAATTGCGGCCCTCGACGCGT
GCTTCGGCCGAGGGGAGCGGCTCTCAGGGCGACGCCCGGCCCATCCACCTCTTGAGGACGCCCAGCTTCGATCCG
CCCGCCTTTACGGCCGACATTGCACCTCCGCCGGCCATCGTCATCGACGTGCCCGACGCGTCGACGCCGCCTCCG
CAGTACGACACCGTCATCGGCACGCCCAGCGTCGACGGTCTGGCCGATTACTTCTCGCGGTTGGCCGACTATGGT
TATCACGACGACGACGATTCGGGCTCAGACTCGGATATCTTGCCTTCGAGGATCCTGGATAGGACGGGGAGGGTC
AACGTCGCGCATCCGAGGACGTCTCGCTCGGGGAGGAGGATGCCGAGTCGGAGTATGGAGATTGCTCGTCCGTCT
GTCAGTCTAAACCTGGAGAATCTGCCGGATCCGAATAGGGGGGCACTCTTGCCGGGGCACGTCATGTAG
Gene >Ophcf2|01716
ATGGTTGACTCTATACCAGCCCCGTCCCAGCCGCGGTCCCGCAACGGCAACTGGGTCATCTCCAGCGGAGGAAAC
GTCTTCTACCGCGTCGACGGCCGATCTCAACCTCCGGCTCCGGCTCTTCCGGCGCCGCTCATCGGGCCCCGCCGC
ACCAGGCCGCACGCCATCCACATCATCACTTACCCTCCCGGATACATCCCCCGAGAGCTGCGGCCCAAAACCCCG
AGCAGATCTAAGAAGGCGGCTCAGTCGCTCCGGGCTCGGACCCTCCTCGGCCGCGGTGACTTGAACGACGGCAGC
CCTCAGCAGGCCCCCGGCTTGAGCAAGCTGCTCGCCTCGTTTGCCCGACCGACCGCCGCCGTCGATCCCCGGCTG
ATCCCGGTCATCGAGCCCCGGCTTCCGGCCTACGACGACGTAGCCGCCACCGATCGTCGCCAGCAGAACCGTCTC
AGCTTGCCTCTCCCGCTGTCCCTGCGACGACCCGACGACAGCTCCTCCTCGTCAAGGCCACACACCACGGAGCGC
TCCCTCACGGCCCCTCCACCCTTCAACATGGCTCACGCCCGCGCCGCTCACTCCGTCGCCGCTCCGCACGCGCCC
GTCGCCCCCCCGGCAGCCTACCGCATCGGGGGCGCCGCCGCCGCCGCCAACGTCAACCGCAACGGCCTCATGTCG
GTACGGTCCGCCAAGTCGGCTGTCAGCCACCTGGTGGCCGAGGTGCCCAAGCCCGTCGCCTCCGGAAGCGGCGTC
TCGTGCTCCATCCTGTTGGCCGAGCCCAACATCTTCCTCTCCGGCTTCGACCACGATCACGACCCTCAGCGCGAC
TCGAGCGGCGGCACCGCCCTGCTCCGCGGCAAGCTGCACCTCTCGGTCAGTAAGAATGTCAAGATCAAGGCCATC
CAGCTCAAGCTGCTCGGACGCGCCCGCACCGAGTGGCCCGAGGGCATCCCCCCGCTCAAGCAGGACGTGGTCGAG
GAGGAGAGCCTGCGGACTCAGGTCTTGACCTTTTTCAACGCCATGAACGATGGCTGGGAGACCGAGTATGGCAAT
CAGTGTTCCTTTAGGCTCCGCGTCGCCTCGACCAACTCGAGCAACACCAACCTCGCCGCCGCGCCCCGAGGACCT
GGTGGAGGACCGGGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGCAGCAGCAGGAGCAGGAGCAGGA
GCAGCAGGAGGAGGTCTGACGCCCGCCATGGCGGCTCACCGCAGCGGCCTCACCGCAAAGGAGCTCAAGCGCCTC
TCCCTACAGAGCGTCCAGTCCCGCAGCTTCGGAAAGGGAGACAGCGGTCTCGCCTCGCCCACCCAGGCCAAGGGA
TTCAAGGTCTTTCACCCGGGCTCGTACGACTACTCGTTCGAGCTGCCCATCGACCATCACCAGCTCGAGACGACC
AAGCTGCCCTTTGGCTCCGTCCGCTGGGAACTGCACGCCACCGTCGACCGCGCCGGGGCTTTCAAGCCGAACCTC
CACGGCATGAAGGAGGTGTCCATCGTCCGGCTACCGGACCAGATGTCGCTCGAGACGACGGAGCCCATCTCCATC
AGCCGCCAGTGGGAGGACCAGCTTCACTACGACATCGTCATCTCGGGCAAGAGTTTCCCGATAGGCTCCAAGATC
CCCATCGCCTTCAAGCTCACGCCGCTGGCCAAGGTGCAGGTACACAAGCTCAAGGTGTACGTGACGGAGACGATC
GAGTACTGGACCAACGATCGGCGCGTCACCCGCAAGGAGCCCGGCCGCAAGATCCTGCTACTGGAGAAGTCGGCC
GGGAAGCCGCTCGATGCCGCCTGGGCCGCCTCGGACATCACCACCATCCGCGGAGGGGAGCCGAGCGCGGAGGAA
CGGCGCAACGCCAGGGAGCTGGCTCAGCGGAGGCGGGCGGCCGACGCGGCCCGTCGACACCGGACGCCGGAGCCC
CTCCCGGACTCGTCGGCCAACCTCCTCGGCGACCTGGATCTCGGGCTGGAGAGCATGTGGGGATCTACGGAGATT
GAGGCCAACGTGCAGATTCCGACGTGCGAGATGATGGCCAAGAACAAGCATCAGAGGCTGAACCCGGACTGCAGC
TGGCGGAACGTCAACGTCTATCACTGGATCAAGGTGGGTTCTCGTCCCTCGTCCCTCGTCCCTCGCCCCCCCTCT
GTTGTCTCGCGACTCGTCCATCGACTCCAATGACCGACTGACTGACCCCCTCTCAGATCGTCATGCGCATCAGCC
GCGCGGACCCCGAGGATCCTACCGGTCACAAGAGACGCCACTTCGAGATCAGTATCGACTCGCCCTTTACCGTCC
TCAACTGCCGAGCCACGCAGGCCAACACGAACCTTCCGGCCTATTCGGGCCCCGTCAGCCAGCCGTCGCCCTTCC
AGGCCTGCTGCGGCTGCCCGGACGCCGCCTCGGTGCCGACCAACATGTCGCCCAGCTCGTCGACGGGCACGCTTC
TGGGCGGTGAGCCGCTCATGGGCGACGCCATGCCCACGCCTCCGCAAGCGGCTCACATGGGTCCCATGATGATTA
CGGAATTGCGGCCCTCGACGCGTGCTTCGGCCGAGGGGAGCGGCTCTCAGGGCGACGCCCGGCCCATCCACCTCT
TGAGGACGCCCAGCTTCGATCCGCCCGCCTTTACGGCCGACATTGCACCTCCGCCGGCCATCGTCATCGACGTGC
CCGACGCGTCGACGCCGCCTCCGCAGTACGACACCGTCATCGGCACGCCCAGCGTCGACGGTCTGGCCGATTACT
TCTCGCGGTTGGCCGACTATGGTTATCACGACGACGACGATTCGGGCTCAGACTCGGATATCTTGCCTTCGAGGA
TCCTGGATAGGACGGGGAGGGTCAACGTCGCGCATCCGAGGACGTCTCGCTCGGGGAGGAGGATGCCGAGTCGGA
GTATGGAGATTGCTCGTCCGTCTGTCAGTCTAAACCTGGAGAATCTGCCGGATCCGAATAGGGGGGCACTCTTGC
CGGGGCACGTCATGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail