Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01708
Gene name
Locationscaffold_02:214818..215885
Strand-
Gene length (bp)1067
Transcript length (bp)996
Coding sequence length (bp)996
Protein length (aa) 332

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12271 Chs7 Chitin synthase export chaperone 1.0E-122 3 286

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.5

Transmembrane Domains

Domain # Start End Length
1 50 72 22
2 85 107 22
3 117 139 22
4 151 173 22
5 188 210 22
6 223 242 19
7 247 269 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01708
MSGFGDFKAICENAPLPLCANVGPILSASGRTGIEPDCYARNIELANTIIFEGAASAMHIAALIMTVVMILHVRS
KFTAVGRKEILTFFYTYMLTTFASLIVDAGVVPPGSASYPYFVSIQNGLSSALVTCLLINGFVGFQLYEDGTPLS
VWMLRFCSLAALAISFLVSLATFKGWAGLGPTNTVGLFVVLYLLNAIQLFIYVAMQILLVTRTLHDRWPLGDISF
GLLFFVAGQVILYAFSANICTAVGHYLDGLFFATTCNLLAVMMVYKYWDSITREDLEFSVGTRMNNWEVKELLPE
DERRATLYADDQPSPYDMPFSPMAQRYSVKG*
Coding >Ophcf2|01708
ATGTCCGGCTTCGGCGACTTCAAAGCCATCTGCGAAAACGCCCCCCTCCCCCTCTGCGCAAATGTCGGTCCCATC
CTCTCGGCCTCGGGCCGCACCGGCATCGAACCAGACTGCTACGCGCGCAACATCGAGCTCGCAAACACAATCATC
TTCGAGGGCGCCGCCTCGGCCATGCACATCGCCGCCCTGATCATGACCGTCGTCATGATCCTACACGTTCGCTCC
AAGTTCACGGCCGTGGGACGAAAGGAGATTCTCACCTTCTTCTACACGTACATGCTCACCACGTTCGCCTCGCTC
ATCGTCGACGCCGGGGTCGTGCCGCCTGGCAGTGCGTCTTACCCTTACTTTGTCAGCATCCAGAATGGGTTGAGC
AGTGCGCTCGTCACCTGTCTGCTCATCAATGGCTTTGTGGGATTCCAGCTCTACGAAGATGGCACGCCCTTGTCG
GTCTGGATGTTGAGGTTCTGCTCCCTCGCTGCCTTGGCCATCAGCTTCCTGGTTTCGCTGGCTACTTTCAAGGGC
TGGGCTGGGCTGGGTCCTACCAACACCGTCGGCCTCTTTGTCGTCCTCTACCTGCTCAACGCCATCCAGCTCTTC
ATCTACGTCGCCATGCAGATCCTGCTCGTCACTCGCACTCTACACGATCGGTGGCCCCTCGGCGACATCTCGTTT
GGCCTGTTGTTCTTCGTCGCCGGACAGGTCATCCTCTACGCCTTCAGCGCCAACATCTGCACTGCCGTCGGTCAT
TACCTCGATGGGCTCTTCTTTGCCACGACGTGCAATCTGCTGGCCGTCATGATGGTGTACAAGTACTGGGACTCG
ATCACGCGCGAGGACCTCGAATTCTCCGTCGGCACCCGCATGAACAACTGGGAAGTCAAGGAGCTTCTGCCCGAA
GACGAGAGGCGCGCCACGCTTTACGCGGACGACCAGCCGAGCCCCTACGACATGCCATTCTCGCCCATGGCGCAA
CGTTACTCGGTCAAGGGCTGA
Transcript >Ophcf2|01708
ATGTCCGGCTTCGGCGACTTCAAAGCCATCTGCGAAAACGCCCCCCTCCCCCTCTGCGCAAATGTCGGTCCCATC
CTCTCGGCCTCGGGCCGCACCGGCATCGAACCAGACTGCTACGCGCGCAACATCGAGCTCGCAAACACAATCATC
TTCGAGGGCGCCGCCTCGGCCATGCACATCGCCGCCCTGATCATGACCGTCGTCATGATCCTACACGTTCGCTCC
AAGTTCACGGCCGTGGGACGAAAGGAGATTCTCACCTTCTTCTACACGTACATGCTCACCACGTTCGCCTCGCTC
ATCGTCGACGCCGGGGTCGTGCCGCCTGGCAGTGCGTCTTACCCTTACTTTGTCAGCATCCAGAATGGGTTGAGC
AGTGCGCTCGTCACCTGTCTGCTCATCAATGGCTTTGTGGGATTCCAGCTCTACGAAGATGGCACGCCCTTGTCG
GTCTGGATGTTGAGGTTCTGCTCCCTCGCTGCCTTGGCCATCAGCTTCCTGGTTTCGCTGGCTACTTTCAAGGGC
TGGGCTGGGCTGGGTCCTACCAACACCGTCGGCCTCTTTGTCGTCCTCTACCTGCTCAACGCCATCCAGCTCTTC
ATCTACGTCGCCATGCAGATCCTGCTCGTCACTCGCACTCTACACGATCGGTGGCCCCTCGGCGACATCTCGTTT
GGCCTGTTGTTCTTCGTCGCCGGACAGGTCATCCTCTACGCCTTCAGCGCCAACATCTGCACTGCCGTCGGTCAT
TACCTCGATGGGCTCTTCTTTGCCACGACGTGCAATCTGCTGGCCGTCATGATGGTGTACAAGTACTGGGACTCG
ATCACGCGCGAGGACCTCGAATTCTCCGTCGGCACCCGCATGAACAACTGGGAAGTCAAGGAGCTTCTGCCCGAA
GACGAGAGGCGCGCCACGCTTTACGCGGACGACCAGCCGAGCCCCTACGACATGCCATTCTCGCCCATGGCGCAA
CGTTACTCGGTCAAGGGCTGA
Gene >Ophcf2|01708
ATGTCCGGCTTCGGCGACTTCAAAGCCATCTGCGAAAACGCCCCCCTCCCCCTCTGCGCAAATGTCGGTCCCATC
CTCTCGGCCTCGGGCCGCACCGGCATCGAACCAGACTGCTACGCGCGCAACATCGAGCTCGCAAACACAATCATC
TTCGAGGGCGCCGCCTCGGCCATGCACATCGCCGCCCTGATCATGACCGTCGTCATGATCCTACACGTTCGCTCC
AAGTTCACGGCCGTGGGACGAAAGGAGATTCTCACCTTCTTCTACACGTACATGCTCACCACGTTCGCCTCGCTC
ATCGTCGACGCCGGGGTCGTGCCGCCTGGCAGTGCGTCTTACCCTTACTTTGTCAGCATCCAGAATGGGTTGAGC
AGTGCGCTCGTCACCTGTCTGCTCATCAATGGCTTTGTGGGATTCCAGCTCTACGAAGATGGCACGCCCTTGTCG
GTCTGGATGTTGAGGTTCTGCTCCCTCGCTGCCTTGGCCATCAGCTTCCTGGTTTCGCTGGCTACTTTCAAGGGC
TGGGCTGGGCTGGGTCCTACCAACACCGTCGGCCTCTTTGTCGTCCTCTACCTGCTCAACGCCATCCAGCTCTTC
ATCTACGTCGCCATGCAGATCCTGCTCGTCACTCGCACTCTACACGATCGGTGGCCCCTCGGCGACATCTCGTTT
GGCCTGTTGTTCTTCGTCGCCGGACAGGTCATCCTCTACGCCTTCAGCGCCAACATCTGCACTGCCGTCGGTCAT
TACCTCGATGGGCTCTTCTTTGCCACGACGTGCAATCTGCTGGCCGTCATGATGGTGTACAAGGTGCGTCACGAC
TCTCATTGATGCCCTCACTGACTGACCCGGTATGCTGATGATGAATGTCTTGTCTCCAGTACTGGGACTCGATCA
CGCGCGAGGACCTCGAATTCTCCGTCGGCACCCGCATGAACAACTGGGAAGTCAAGGAGCTTCTGCCCGAAGACG
AGAGGCGCGCCACGCTTTACGCGGACGACCAGCCGAGCCCCTACGACATGCCATTCTCGCCCATGGCGCAACGTT
ACTCGGTCAAGGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail