Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01707
Gene name
Locationscaffold_02:207319..210731
Strand-
Gene length (bp)3412
Transcript length (bp)3189
Coding sequence length (bp)3189
Protein length (aa) 1063

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12511 DUF3716 Protein of unknown function (DUF3716) 3.6E-08 350 397

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2962 0.9165 0.1866 0.0251 0.0826 0.0089 0.0233 0.0262 0.0161 0.0019

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2296
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1157
Ophiocordyceps australis map64 (Brazil) OphauB2|3802
Ophiocordyceps camponoti-floridani Ophcf2|01707 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|198
Ophiocordyceps kimflemingae Ophio5|4297
Ophiocordyceps subramaniannii Hirsu2|3042

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01707
MAMSTPPINMASRPGPDESAAWTSLPADEQRSVWDETENKFWHGFEHEQDAIRANLENNWRKATVGIRVELGSLD
GRRSLLAEVRDRLSRELAAVDVEIARLVDACEDKAGRLVAMEQSYRRAEQDRLENREKVVRKMETFFREKRGDGP
TSSDTARARDRMTRRLPVSLLSSSSSSSISSSTSSPPSSSSPRAAEERLRHALPARPMHVHAAPSTPLAQARAQQ
AHAQAEAQAQHAHAHAHAHAEAQALAMHANKASGPVTKTEPSQSPPPPPPSLLRPADTLVEVTDADGHVLGPVRR
IEPWNQWVKEIQDLPVHRKVKIRRGRKFSQEHLASIYDRSEGKGVKWLSCMIQATGEIQSQRCHSCDKNQGAFDD
CVILGGPLFPKCGNCEWNRQGCHIPLVTKSVNPGFPLNGRPWKRPLEMSLDQSSAVLDDAALRAAGIARAAVMES
ARAMEPAVADPHRSPTAKPEPVLQMPTPQEPREHSFAGHPGCFPASLPSNGFTPANGFTPANVRGGPPPSRPPSR
DMPTPSVASADGSPGASPAALEPLEEITRENLVLRHNGTVYTEPEIVAGVPLAKIDQNHPYWELGWPGIRSVIEP
QLESWREKNAAALQATARGEGGSAKFQTGRQVNRGLRILDFLDNGDISPYQLLGKRFTHTGKGAITSYDTLFRLC
ETLSELAKFNLDVTPVEWLRHRLHEIRMVKGSGFNVSKTIHDFYHDPKLSALRSKNGYKSIGRPSGYKTTTATTT
TTTTTTTTTGTPTSVSSAKKRKAMHPYVATPRGTPPAAAVDFGGRSPVSMDDGSTAAMVVERPGTPLEARPGKRL
KAESPWQPSPPPPPSHPPPHPHPPPRPPPTSAHPPSTMEETRESPPPSTMESRESPPTSTTRASPDDVDAHHSDK
DSLCGAPLTRDDWRLYQVKTRLFTSSIQVTQYWSWKDQDRLLEHQVLGDVEPISWGLHRAPIDFHVRLDDVVEVR
WNVDALQVRLVTDSSDSRVSSLDGKPRGDVMAAFKRENTIRRFLSFCRARGLKTTEVSADEMDAEWGAMKSEQLP
VRDDEASEVLKE*
Coding >Ophcf2|01707
ATGGCCATGTCGACGCCTCCCATCAACATGGCCAGTCGCCCCGGCCCGGACGAATCAGCAGCCTGGACTTCGCTC
CCCGCCGACGAGCAGCGATCGGTATGGGACGAGACGGAGAATAAGTTTTGGCACGGCTTCGAGCACGAGCAGGAT
GCCATTCGCGCCAACCTCGAGAACAACTGGCGCAAGGCCACCGTCGGCATCCGCGTCGAGCTCGGGAGTCTGGAT
GGTCGTCGCTCCTTGCTGGCCGAGGTGCGGGATCGGTTATCGCGAGAGCTGGCGGCCGTGGATGTCGAGATTGCC
CGCTTGGTCGACGCCTGTGAGGACAAGGCCGGTCGCCTGGTGGCCATGGAGCAGAGCTATCGCAGGGCGGAGCAG
GATCGGCTTGAGAATCGGGAAAAGGTGGTTCGCAAGATGGAGACCTTCTTCCGCGAGAAGCGTGGCGACGGCCCC
ACCTCGTCCGACACGGCGCGTGCCCGAGATCGGATGACGCGCCGGCTTCCCGTTTCGCTGCTATCGTCGTCATCA
TCCTCGTCGATATCCTCGTCGACTTCCTCGCCGCCGTCGTCGTCGTCGCCACGAGCCGCCGAGGAGCGTCTTCGT
CATGCCCTCCCTGCGCGTCCCATGCACGTACACGCCGCTCCTTCGACGCCCTTGGCTCAGGCTCGGGCTCAGCAG
GCTCACGCCCAGGCCGAGGCCCAGGCGCAACACGCTCACGCTCACGCTCACGCTCACGCCGAGGCTCAGGCTCTG
GCCATGCACGCAAACAAGGCCTCGGGCCCGGTCACCAAGACGGAACCGTCCCAATCTCCACCTCCACCACCGCCC
AGCTTGCTCCGTCCGGCCGATACCCTCGTCGAAGTCACCGATGCCGACGGCCACGTGCTCGGCCCCGTCCGCCGC
ATCGAACCGTGGAACCAGTGGGTCAAGGAGATCCAGGACCTACCCGTCCACCGCAAGGTCAAGATCCGACGCGGC
AGAAAGTTCAGCCAGGAGCATCTCGCCAGCATCTACGATCGCTCCGAGGGCAAGGGCGTCAAGTGGCTGTCGTGC
ATGATTCAGGCCACGGGCGAGATCCAGTCGCAGCGATGCCATTCCTGTGACAAGAACCAGGGCGCCTTTGACGAC
TGCGTCATCCTCGGCGGGCCGCTCTTCCCCAAGTGCGGGAACTGTGAGTGGAATCGTCAGGGCTGTCATATACCT
CTCGTCACCAAGTCGGTCAACCCCGGGTTTCCCCTCAATGGCCGGCCGTGGAAGAGGCCGCTGGAGATGTCGCTC
GACCAGTCTTCGGCCGTCCTCGACGACGCCGCCCTCCGGGCCGCCGGCATCGCTCGCGCTGCCGTCATGGAGTCG
GCCCGCGCCATGGAGCCGGCCGTCGCGGACCCCCACCGGTCGCCCACCGCCAAGCCGGAGCCGGTCTTGCAGATG
CCGACGCCTCAGGAGCCCCGCGAGCACTCGTTCGCCGGCCATCCGGGCTGCTTCCCGGCCTCTTTACCCTCCAAC
GGCTTCACGCCCGCCAACGGCTTCACGCCGGCAAACGTCCGCGGCGGTCCTCCTCCGTCCAGGCCCCCGTCGCGG
GACATGCCGACACCTTCGGTCGCCTCGGCCGATGGCTCCCCCGGCGCCTCGCCCGCGGCCCTCGAGCCGCTCGAG
GAGATTACGCGTGAGAACCTGGTGCTGAGGCACAACGGCACCGTCTACACCGAGCCCGAGATCGTCGCCGGCGTC
CCCTTGGCCAAGATTGACCAGAACCATCCGTACTGGGAACTCGGCTGGCCCGGCATCCGGTCCGTCATAGAGCCC
CAGCTCGAGTCGTGGCGCGAAAAGAACGCGGCCGCCCTGCAGGCCACTGCCAGGGGCGAGGGCGGCTCTGCCAAG
TTCCAGACGGGCAGGCAGGTCAACCGCGGCCTGCGGATCCTCGACTTTCTCGATAACGGCGACATCAGCCCCTAC
CAGCTGCTGGGAAAGAGGTTCACCCACACGGGCAAGGGCGCCATCACCTCGTACGACACCCTGTTCCGCCTCTGC
GAGACGCTGTCGGAGCTGGCCAAGTTTAACCTGGACGTGACGCCCGTCGAGTGGTTGCGTCATCGGCTGCACGAG
ATCCGCATGGTCAAGGGCTCCGGTTTCAACGTTTCCAAGACGATACACGACTTTTATCACGATCCCAAGCTGTCT
GCCCTGAGGAGTAAGAACGGCTACAAGAGCATAGGCCGGCCTTCGGGATACAAGACGACGACGGCGACGACGACG
ACGACGACGACGACGACGACGACGACGGGGACGCCCACGTCGGTCTCTTCGGCTAAGAAGCGCAAGGCCATGCAT
CCGTACGTCGCCACTCCGCGAGGGACGCCGCCGGCCGCTGCCGTCGACTTTGGCGGACGGTCACCCGTGTCCATG
GACGACGGATCGACGGCGGCCATGGTGGTCGAGAGGCCCGGTACGCCTCTGGAGGCGAGGCCCGGCAAGCGTCTC
AAGGCCGAGTCGCCTTGGCAGCCGTCTCCTCCTCCTCCCCCTTCTCATCCTCCTCCTCATCCTCATCCACCACCT
CGGCCTCCTCCCACTTCTGCTCATCCGCCGTCGACGATGGAGGAGACCCGCGAATCACCTCCGCCGTCGACGATG
GAGTCTCGCGAGTCTCCCCCGACGTCGACGACGCGCGCGTCCCCCGACGACGTAGACGCCCATCACAGCGACAAG
GACTCGCTGTGCGGCGCGCCCTTGACCCGGGATGACTGGCGACTGTATCAGGTCAAGACGAGGCTCTTCACCAGC
TCCATCCAGGTGACGCAGTACTGGAGCTGGAAGGACCAGGATCGACTGCTCGAGCACCAGGTCCTCGGCGACGTG
GAACCCATCTCGTGGGGCCTCCACCGCGCGCCCATCGACTTCCACGTCCGGCTGGACGACGTTGTCGAGGTGCGG
TGGAACGTGGACGCGCTTCAGGTGCGACTCGTCACGGACTCGTCCGACTCCCGGGTGTCGTCGTTGGATGGCAAG
CCGAGGGGGGACGTCATGGCTGCTTTCAAGCGGGAGAATACCATCCGTCGCTTCCTGAGCTTCTGTCGCGCGAGG
GGGCTCAAGACGACCGAGGTGTCTGCGGATGAGATGGATGCCGAATGGGGGGCCATGAAGTCGGAGCAGCTGCCG
GTGAGGGACGACGAGGCCAGCGAGGTGCTGAAGGAGTAG
Transcript >Ophcf2|01707
ATGGCCATGTCGACGCCTCCCATCAACATGGCCAGTCGCCCCGGCCCGGACGAATCAGCAGCCTGGACTTCGCTC
CCCGCCGACGAGCAGCGATCGGTATGGGACGAGACGGAGAATAAGTTTTGGCACGGCTTCGAGCACGAGCAGGAT
GCCATTCGCGCCAACCTCGAGAACAACTGGCGCAAGGCCACCGTCGGCATCCGCGTCGAGCTCGGGAGTCTGGAT
GGTCGTCGCTCCTTGCTGGCCGAGGTGCGGGATCGGTTATCGCGAGAGCTGGCGGCCGTGGATGTCGAGATTGCC
CGCTTGGTCGACGCCTGTGAGGACAAGGCCGGTCGCCTGGTGGCCATGGAGCAGAGCTATCGCAGGGCGGAGCAG
GATCGGCTTGAGAATCGGGAAAAGGTGGTTCGCAAGATGGAGACCTTCTTCCGCGAGAAGCGTGGCGACGGCCCC
ACCTCGTCCGACACGGCGCGTGCCCGAGATCGGATGACGCGCCGGCTTCCCGTTTCGCTGCTATCGTCGTCATCA
TCCTCGTCGATATCCTCGTCGACTTCCTCGCCGCCGTCGTCGTCGTCGCCACGAGCCGCCGAGGAGCGTCTTCGT
CATGCCCTCCCTGCGCGTCCCATGCACGTACACGCCGCTCCTTCGACGCCCTTGGCTCAGGCTCGGGCTCAGCAG
GCTCACGCCCAGGCCGAGGCCCAGGCGCAACACGCTCACGCTCACGCTCACGCTCACGCCGAGGCTCAGGCTCTG
GCCATGCACGCAAACAAGGCCTCGGGCCCGGTCACCAAGACGGAACCGTCCCAATCTCCACCTCCACCACCGCCC
AGCTTGCTCCGTCCGGCCGATACCCTCGTCGAAGTCACCGATGCCGACGGCCACGTGCTCGGCCCCGTCCGCCGC
ATCGAACCGTGGAACCAGTGGGTCAAGGAGATCCAGGACCTACCCGTCCACCGCAAGGTCAAGATCCGACGCGGC
AGAAAGTTCAGCCAGGAGCATCTCGCCAGCATCTACGATCGCTCCGAGGGCAAGGGCGTCAAGTGGCTGTCGTGC
ATGATTCAGGCCACGGGCGAGATCCAGTCGCAGCGATGCCATTCCTGTGACAAGAACCAGGGCGCCTTTGACGAC
TGCGTCATCCTCGGCGGGCCGCTCTTCCCCAAGTGCGGGAACTGTGAGTGGAATCGTCAGGGCTGTCATATACCT
CTCGTCACCAAGTCGGTCAACCCCGGGTTTCCCCTCAATGGCCGGCCGTGGAAGAGGCCGCTGGAGATGTCGCTC
GACCAGTCTTCGGCCGTCCTCGACGACGCCGCCCTCCGGGCCGCCGGCATCGCTCGCGCTGCCGTCATGGAGTCG
GCCCGCGCCATGGAGCCGGCCGTCGCGGACCCCCACCGGTCGCCCACCGCCAAGCCGGAGCCGGTCTTGCAGATG
CCGACGCCTCAGGAGCCCCGCGAGCACTCGTTCGCCGGCCATCCGGGCTGCTTCCCGGCCTCTTTACCCTCCAAC
GGCTTCACGCCCGCCAACGGCTTCACGCCGGCAAACGTCCGCGGCGGTCCTCCTCCGTCCAGGCCCCCGTCGCGG
GACATGCCGACACCTTCGGTCGCCTCGGCCGATGGCTCCCCCGGCGCCTCGCCCGCGGCCCTCGAGCCGCTCGAG
GAGATTACGCGTGAGAACCTGGTGCTGAGGCACAACGGCACCGTCTACACCGAGCCCGAGATCGTCGCCGGCGTC
CCCTTGGCCAAGATTGACCAGAACCATCCGTACTGGGAACTCGGCTGGCCCGGCATCCGGTCCGTCATAGAGCCC
CAGCTCGAGTCGTGGCGCGAAAAGAACGCGGCCGCCCTGCAGGCCACTGCCAGGGGCGAGGGCGGCTCTGCCAAG
TTCCAGACGGGCAGGCAGGTCAACCGCGGCCTGCGGATCCTCGACTTTCTCGATAACGGCGACATCAGCCCCTAC
CAGCTGCTGGGAAAGAGGTTCACCCACACGGGCAAGGGCGCCATCACCTCGTACGACACCCTGTTCCGCCTCTGC
GAGACGCTGTCGGAGCTGGCCAAGTTTAACCTGGACGTGACGCCCGTCGAGTGGTTGCGTCATCGGCTGCACGAG
ATCCGCATGGTCAAGGGCTCCGGTTTCAACGTTTCCAAGACGATACACGACTTTTATCACGATCCCAAGCTGTCT
GCCCTGAGGAGTAAGAACGGCTACAAGAGCATAGGCCGGCCTTCGGGATACAAGACGACGACGGCGACGACGACG
ACGACGACGACGACGACGACGACGACGGGGACGCCCACGTCGGTCTCTTCGGCTAAGAAGCGCAAGGCCATGCAT
CCGTACGTCGCCACTCCGCGAGGGACGCCGCCGGCCGCTGCCGTCGACTTTGGCGGACGGTCACCCGTGTCCATG
GACGACGGATCGACGGCGGCCATGGTGGTCGAGAGGCCCGGTACGCCTCTGGAGGCGAGGCCCGGCAAGCGTCTC
AAGGCCGAGTCGCCTTGGCAGCCGTCTCCTCCTCCTCCCCCTTCTCATCCTCCTCCTCATCCTCATCCACCACCT
CGGCCTCCTCCCACTTCTGCTCATCCGCCGTCGACGATGGAGGAGACCCGCGAATCACCTCCGCCGTCGACGATG
GAGTCTCGCGAGTCTCCCCCGACGTCGACGACGCGCGCGTCCCCCGACGACGTAGACGCCCATCACAGCGACAAG
GACTCGCTGTGCGGCGCGCCCTTGACCCGGGATGACTGGCGACTGTATCAGGTCAAGACGAGGCTCTTCACCAGC
TCCATCCAGGTGACGCAGTACTGGAGCTGGAAGGACCAGGATCGACTGCTCGAGCACCAGGTCCTCGGCGACGTG
GAACCCATCTCGTGGGGCCTCCACCGCGCGCCCATCGACTTCCACGTCCGGCTGGACGACGTTGTCGAGGTGCGG
TGGAACGTGGACGCGCTTCAGGTGCGACTCGTCACGGACTCGTCCGACTCCCGGGTGTCGTCGTTGGATGGCAAG
CCGAGGGGGGACGTCATGGCTGCTTTCAAGCGGGAGAATACCATCCGTCGCTTCCTGAGCTTCTGTCGCGCGAGG
GGGCTCAAGACGACCGAGGTGTCTGCGGATGAGATGGATGCCGAATGGGGGGCCATGAAGTCGGAGCAGCTGCCG
GTGAGGGACGACGAGGCCAGCGAGGTGCTGAAGGAGTAG
Gene >Ophcf2|01707
ATGGCCATGTCGACGCCTCCCATCAACATGGCCAGTCGCCCCGGCCCGGACGAATCAGCAGCCTGGACTTCGCTC
CCCGCCGACGAGCAGCGATCGGTATGGGACGAGACGGAGAATAAGTTTTGGCACGGCTTCGAGCACGAGCAGGAT
GCCATTCGCGCCAACCTCGAGAACAACTGGCGCAAGGCCACCGTCGGCATCCGCGTCGAGCTCGGGAGTCTGGAT
GGTCGTCGCTCCTTGCTGGCCGAGGTGCGGGATCGGTTATCGCGAGAGCTGGCGGCCGTGGATGTCGAGATTGCC
CGCTTGGTCGACGCCTGTGAGGACAAGGCCGGTCGCCTGGTGGCCATGGAGCAGAGCTATCGCAGGGCGGAGCAG
GATCGGCTTGAGAATCGGGAAAAGGTGGTTCGCAAGATGGAGACCTTCTTCCGCGAGAAGCGTGGCGACGGCCCC
ACCTCGTCCGACACGGCGCGTGCCCGAGATCGGATGACGCGCCGGCTTCCCGTTTCGCTGCTATCGTCGTCATCA
TCCTCGTCGATATCCTCGTCGACTTCCTCGCCGCCGTCGTCGTCGTCGCCACGAGCCGCCGAGGAGCGTCTTCGT
CATGCCCTCCCTGCGCGTCCCATGCACGTACACGCCGCTCCTTCGACGCCCTTGGCTCAGGCTCGGGCTCAGCAG
GCTCACGCCCAGGCCGAGGCCCAGGCGCAACACGCTCACGCTCACGCTCACGCTCACGCCGAGGCTCAGGCTCTG
GCCATGCACGCAAACAAGGCCTCGGGCCCGGTCACCAAGACGGAACCGTCCCAATCTCCGTATCCTCCTTCTCGT
TCCCATCCTCCTTCTCATCGCCTTCCCCATCCTCCTTCTCATCACCCACCTCCTCCGCCTCCACCTTCACATCCG
CCTCCTCCTCCTCCTCCTCCTCCTCCTTCCCTTCCCCCCCATCCCATCTCGACAACGGCATCCCGCCCCCCAGAC
CTCCACCACCGCCCAGCTTGCTCCGTCCGGCCGATACCCTCGTCGAAGTCACCGATGCCGACGGCCACGTGCTCG
GCCCCGTCCGCCGCATCGAACCGTGGAACCAGTGGGTCAAGGAGATCCAGGACCTACCCGTCCACCGCAAGGTCA
AGATCCGACGCGGCAGAAAGTTCAGCCAGGAGCATCTCGCCAGCATCTACGATCGCTCCGAGGGCAAGGGCGTCA
AGTGGCTGTCGTGCATGATTCAGGCCACGGGCGAGATCCAGTCGCAGCGATGCCATTCCTGTGACAAGAACCAGG
GCGCCTTTGACGACTGCGTCATCCTCGGCGGGCCGCTCTTCCCCAAGTGCGGGAACTGTGAGTGGAATCGTCAGG
GCTGTCATATACCTCTCGTCACCAAGTCGGTCAACCCCGGGTTTCCCCTCAATGGCCGGCCGTGGAAGAGGCCGC
TGGAGATGTCGCTCGACCAGTCTTCGGCCGTCCTCGACGACGCCGCCCTCCGGGCCGCCGGCATCGCTCGCGCTG
CCGTCATGGAGTCGGCCCGCGCCATGGAGCCGGCCGTCGCGGACCCCCACCGGTCGCCCACCGCCAAGCCGGAGC
CGGTCTTGCAGATGCCGACGCCTCAGGAGCCCCGCGAGCACTCGTTCGCCGGCCATCCGGGCTGCTTCCCGGCCT
CTTTACCCTCCAACGGCTTCACGCCCGCCAACGGCTTCACGCCGGCAAACGTCCGCGGCGGTCCTCCTCCGTCCA
GGCCCCCGTCGCGGGACATGCCGACACCTTCGGTCGCCTCGGCCGATGGCTCCCCCGGCGCCTCGCCCGCGGCCC
TCGAGCCGCTCGAGGAGATTACGCGTGAGAACCTGGTGCTGAGGCACAACGGCACCGTCTACACCGAGCCCGAGA
TCGTCGCCGGCGTCCCCTTGGCCAAGATTGACCAGAACCATCCGTACTGGGAACTCGGCTGGCCCGGCATCCGGT
CCGTCATAGAGCCCCAGCTCGAGTCGTGGCGCGAAAAGAACGCGGCCGCCCTGCAGGCCACTGCCAGGGGCGAGG
GCGGCTCTGCCAAGTTCCAGACGGGCAGGCAGGTCAACCGCGGCCTGCGGATCCTCGACTTTCTCGATAACGGCG
ACATCAGCCCCTACCAGCTGCTGGGAAAGAGGTTCACCCACACGGGCAAGGGCGCCATCACCTCGTACGACACCC
TGTTCCGCCTCTGCGAGACGCTGTCGGAGCTGGCCAAGTTTAACCTGGACGTGACGCCCGTCGAGTGGTTGCGTC
ATCGGCTGCACGAGATCCGCATGGTCAAGGGCTCCGGTTTCAACGTTTCCAAGACGATACACGACTTTTATCACG
ATCCCAAGCTGTCTGCCCTGAGGAGTAAGAACGGCTACAAGAGCATAGGCCGGCCTTCGGGATACAAGACGACGA
CGGCGACGACGACGACGACGACGACGACGACGACGACGACGGGGACGCCCACGTCGGTCTCTTCGGCTAAGAAGC
GCAAGGCCATGCATCCGTACGTCGCCACTCCGCGAGGGACGCCGCCGGCCGCTGCCGTCGACTTTGGCGGACGGT
CACCCGTGTCCATGGACGACGGATCGACGGCGGCCATGGTGGTCGAGAGGCCCGGTACGCCTCTGGAGGCGAGGC
CCGGCAAGCGTCTCAAGGCCGAGTCGCCTTGGCAGCCGTCTCCTCCTCCTCCCCCTTCTCATCCTCCTCCTCATC
CTCATCCACCACCTCGGCCTCCTCCCACTTCTGCTCATCCGCCGTCGACGATGGAGGAGACCCGCGAATCACCTC
CGCCGTCGACGATGGAGTCTCGCGAGTCTCCCCCGACGTCGACGACGCGCGCGTCCCCCGACGACGTAGACGCCC
ATCACAGCGACAAGGACTCGCTGTGCGGCGCGCCCTTGACCCGGGATGACTGGCGACTGTATCAGGTCAAGACGA
GGCTCTTCACCAGCTCCATCCAGGTGACGCAGTACTGGAGCTGGAAGGACCAGGATCGACTGCTCGAGCACCAGG
TCCTCGGCGACGTGGAACCCATCTCGTGGGGCCTCCACCGCGCGCCCATCGACTTCCACGTCCGGCTGGACGACG
TTGTCGAGGTGCGGTGGAACGTGGACGCGCTTCAGGTGCGACTCGTCACGGACTCGTCCGACTCCCGGGTGTCGT
CGTTGGATGGCAAGCCGAGGGGGGACGTCATGGCTGCTTTCAAGCGGGAGAATACCATCCGTCGCTTCCTGAGCT
TCTGTCGCGCGAGGGGGCTCAAGACGACCGAGGTGTCTGCGTGAGTTTGGCTCCCTGTTGGGCTCTCGTGCTCGG
CCGGCTAACTTTTTTTTTCCAAAGGGATGAGATGGATGCCGAATGGGGGGCCATGAAGTCGGAGCAGCTGCCGGT
GAGGGACGACGAGGCCAGCGAGGTGCTGAAGGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail